Mouse CAND1 Monoclonal Antibody | anti-CAND1 antibody

CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (APC)

Cat. Num. AAA26100

• Gene Names: CAND1; TIP120; TIP120A
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: CAND1, Antibody; CAND1 (Cullin-Associated and Neddylation-dissociated 1, DKFZp434M1414, FLJ10114, FLJ10929, FLJ38691, FLJ90441, KIAA0829, TIP120, TIP120A) (APC); Cullin-Associated and Neddylation-dissociated 1; DKFZp434M1414; FLJ10114; FLJ10929; FLJ38691; FLJ90441; KIAA0829; TIP120; TIP120A; anti-CAND1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG3,k
• Clone Number: 4D10
• Specificity: Recognizes CAND1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-CAND1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CAND1 (NP_060918, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDKNGEVQNLAVKCLGPLVSKVKEYQVETIVDTLCTNMLSDKE
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(CAND1 monoclonal antibody (M04), clone 4D10. Western Blot analysis of CAND1 expression in Raw 264.7.)

WB (Western Blot)

(CAND1 monoclonal antibody (M04), clone 4D10. Western Blot analysis of CAND1 expression in PC-12.)

WB (Western Blot)

(CAND1 monoclonal antibody (M04), clone 4D10. Western Blot analysis of CAND1 expression in NIH/3T3.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CAND1 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(CAND1 monoclonal antibody (M04), clone 4D10 Western Blot analysis of CAND1 expression in Hela S3 NE.)

Related Product Information for anti-CAND1 antibody

Mouse monoclonal antibody raised against a partial recombinant CAND1.

Product Categories/Family for anti-CAND1 antibody

Antibodies; Cullin

NCBI and Uniprot Product Information

• NCBI GI #: 21361794
• NCBI GeneID: 55832
• NCBI Accession #: NP_060918
• NCBI GenBank Nucleotide #: NM_018448
• UniProt Accession #: Q86VP6
• Molecular Weight: 136kDa
• NCBI Official Full Name: cullin-associated NEDD8-dissociated protein 1 isoform 1
• NCBI Official Synonym Full Names: cullin associated and neddylation dissociated 1
• NCBI Official Symbol: CAND1
• NCBI Official Synonym Symbols: TIP120; TIP120A
• NCBI Protein Information: cullin-associated NEDD8-dissociated protein 1
• UniProt Protein Name: Cullin-associated NEDD8-dissociated protein 1
• UniProt Gene Name: CAND1
• UniProt Synonym Gene Names: KIAA0829; TIP120; TIP120A; TBP-interacting protein 120A