Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282735_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and caspase-8 knockout (KO) HeLa cells using [KO Validated] Caspase-8 Rabbit mAb (AAA282735) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:5000 dilution.Lysates/proteins: 30 ug per lane.Blocking buffer: 5% nonfat dry milk in TBST.Exposure time: 60s.<b>The data were kindly provided by Dr. Feng Shao, NIBS</b>)

Rabbit anti-Human Caspase-8 Monoclonal Antibody | anti-CASP8 antibody

[KO Validated] Caspase-8 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
Caspase-8, Antibody; [KO Validated] Caspase-8 Rabbit mAb; CAP4; MACH; MCH5; FLICE; ALPS2B; Casp-8; Caspase-8; anti-CASP8 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
EELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ
Applicable Applications for anti-CASP8 antibody
ELISA, WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-8 (Q14790).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and caspase-8 knockout (KO) HeLa cells using [KO Validated] Caspase-8 Rabbit mAb (AAA282735) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:5000 dilution.Lysates/proteins: 30 ug per lane.Blocking buffer: 5% nonfat dry milk in TBST.Exposure time: 60s.<b>The data were kindly provided by Dr. Feng Shao, NIBS</b>)

product-image-AAA282735_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and caspase-8 knockout (KO) HeLa cells using [KO Validated] Caspase-8 Rabbit mAb (AAA282735) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:5000 dilution.Lysates/proteins: 30 ug per lane.Blocking buffer: 5% nonfat dry milk in TBST.Exposure time: 60s.<b>The data were kindly provided by Dr. Feng Shao, NIBS</b>)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] Caspase-8 Rabbit mAb (AAA282735) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA282735_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using [KO Validated] Caspase-8 Rabbit mAb (AAA282735) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-CASP8 antibody
This gene encodes a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes composed of a prodomain, a large protease subunit, and a small protease subunit. Activation of caspases requires proteolytic processing at conserved internal aspartic residues to generate a heterodimeric enzyme consisting of the large and small subunits. This protein is involved in the programmed cell death induced by Fas and various apoptotic stimuli. The N-terminal FADD-like death effector domain of this protein suggests that it may interact with Fas-interacting protein FADD. This protein was detected in the insoluble fraction of the affected brain region from Huntington disease patients but not in those from normal controls, which implicated the role in neurodegenerative diseases. Many alternatively spliced transcript variants encoding different isoforms have been described, although not all variants have had their full-length sequences determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
841
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 55kDa
Observed MW: 57kDa
UniProt Protein Name
Caspase-8
UniProt Gene Name
CASP8
UniProt Synonym Gene Names
MCH5; CASP-8; FLICE; MACH
UniProt Entry Name
CASP8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CASP8 casp8 (Catalog #AAA282735) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Caspase-8 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Caspase-8 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the CASP8 casp8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EELCGVMTIS DSPREQDSES QTLDKVYQMK SKPRGYCLII NNHNFAKARE KVPKLHSIRD RNGTHLDAGA LTTTFEELHF EIKPHDDCTV EQIYEILKIY Q. It is sometimes possible for the material contained within the vial of "Caspase-8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.