Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA24213_WB6.jpg WB (Western Blot) (FLJ20097 monoclonal antibody, Western Blot analysis of FLJ20097 expression in HeLa.)

Mouse anti-Human, Mouse CCDC132 Monoclonal Antibody | anti-CCDC132 antibody

CCDC132 (Coiled-coil Domain-containing Protein 132, KIAA1861, DKFZp313I2429, FLJ20097, FLJ23581, KIAA1861, MGC176659) (AP)

Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCDC132, Antibody; CCDC132 (Coiled-coil Domain-containing Protein 132, KIAA1861, DKFZp313I2429, FLJ20097, FLJ23581, KIAA1861, MGC176659) (AP); anti-CCDC132 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D11
Specificity
Recognizes human FLJ20097. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
964
Applicable Applications for anti-CCDC132 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa862-965 from human FLJ20097 (NP_060137) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(FLJ20097 monoclonal antibody, Western Blot analysis of FLJ20097 expression in HeLa.)

product-image-AAA24213_WB6.jpg WB (Western Blot) (FLJ20097 monoclonal antibody, Western Blot analysis of FLJ20097 expression in HeLa.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FLJ20097 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA24213_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to FLJ20097 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FLJ20097 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

product-image-AAA24213_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to FLJ20097 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

WB (Western Blot)

(FLJ20097 monoclonal antibody. Western Blot analysis of FLJ20097 expression in NIH/3T3.)

product-image-AAA24213_WB3.jpg WB (Western Blot) (FLJ20097 monoclonal antibody. Western Blot analysis of FLJ20097 expression in NIH/3T3.)

WB (Western Blot)

(FLJ20097 monoclonal antibody. Western Blot analysis of FLJ20097 expression in human pancreas.)

product-image-AAA24213_WB2.jpg WB (Western Blot) (FLJ20097 monoclonal antibody. Western Blot analysis of FLJ20097 expression in human pancreas.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.44kD).)

product-image-AAA24213_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.44kD).)
Product Categories/Family for anti-CCDC132 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
syndetin isoform a
UniProt Protein Name
Coiled-coil domain-containing protein 132
UniProt Gene Name
CCDC132
UniProt Synonym Gene Names
KIAA1861
UniProt Entry Name
CC132_HUMAN

Similar Products

Product Notes

The CCDC132 ccdc132 (Catalog #AAA24213) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCDC132 (Coiled-coil Domain-containing Protein 132, KIAA1861, DKFZp313I2429, FLJ20097, FLJ23581, KIAA1861, MGC176659) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC132 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCDC132 ccdc132 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCDC132, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.