Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA25045_WB6.jpg WB (Western Blot) (CCNH monoclonal antibody, Western Blot analysis of CCNH expression in HeLa.)

Mouse anti-Human CCNH Monoclonal Antibody | anti-CCNH antibody

CCNH (Cyclin H, Cyclin-H, MO15-associated Protein, p34, p37) (FITC)

Gene Names
CCNH; CAK; p34; p37; CycH
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCNH, Antibody; CCNH (Cyclin H, Cyclin-H, MO15-associated Protein, p34, p37) (FITC); anti-CCNH antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B8
Specificity
Recognizes human CCNH.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CCNH antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from human CCNH (AAH05280) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAF
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(CCNH monoclonal antibody, Western Blot analysis of CCNH expression in HeLa.)

product-image-AAA25045_WB6.jpg WB (Western Blot) (CCNH monoclonal antibody, Western Blot analysis of CCNH expression in HeLa.)

Application Data

(Detection limit for recombinant GST tagged CCNH is ~1ng/ml as a capture antibody.)

product-image-AAA25045_APP5.jpg Application Data (Detection limit for recombinant GST tagged CCNH is ~1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CCNH on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA25045_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CCNH on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CCNH on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

product-image-AAA25045_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CCNH on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of CCNH expression in transfected 293T cell line by CCNH monoclonal antibody. Lane 1: CCNH transfected lysate (37.6kD). Lane 2: Non-transfected lysate.)

product-image-AAA25045_WB2.jpg WB (Western Blot) (Western Blot analysis of CCNH expression in transfected 293T cell line by CCNH monoclonal antibody. Lane 1: CCNH transfected lysate (37.6kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.73kD).)

product-image-AAA25045_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.73kD).)
Product Categories/Family for anti-CCNH antibody
References
1. Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair. Nakazawa Y, Sasaki K, Mitsutake N, Matsuse M, Shimada M, Nardo T, Takahashi Y, Ohyama K, Ito K, Mishima H, Nomura M, Kinoshita A, Ono S, Takenaka K, Masuyama R, Kudo T, Slor H, Utani A, Tateishi S, Yamashita S, Stefanini M, Lehmann AR, Yoshiura KI, Ogi T.Nat Genet. 2012 Apr 1. doi: 10.1038/ng.2229.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
902
Molecular Weight
37,643 Da
NCBI Official Full Name
Homo sapiens cyclin H, mRNA
NCBI Official Synonym Full Names
cyclin H
NCBI Official Symbol
CCNH
NCBI Official Synonym Symbols
CAK; p34; p37; CycH
NCBI Protein Information
cyclin-H

Similar Products

Product Notes

The CCNH (Catalog #AAA25045) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCNH (Cyclin H, Cyclin-H, MO15-associated Protein, p34, p37) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCNH can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCNH for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCNH, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.