Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282846_AD11.jpg Application Data (Human peripheral blood lymphocytes stained with CD3E+CD3G Rabbit mAb (AAA282846) (1ug/mL) (orange). Secondary antibody only staining (Blue) and unstained sample (red) were used as a control.)

Rabbit anti-Human CD3E+CD3G Monoclonal Antibody | anti-CD3(epsilon+gamma)/CD3E+CD3G antibody

CD3E+CD3G Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Flow Cytometry, Functional Assay, Western Blot
Purity
Affinity purification
Synonyms
CD3E+CD3G, Antibody; CD3E+CD3G Rabbit mAb; CD3E; IMD18; T3E; TCRE; CD3e molecule; CD3G; CD3-GAMMA; IMD17; T3G; CD3E+CD3G; anti-CD3(epsilon+gamma)/CD3E+CD3G antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI(CD3E)&MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN(CD3G)
Applicable Applications for anti-CD3(epsilon+gamma)/CD3E+CD3G antibody
ELISA, FCM/FACS (Flow Cytometry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-207(CD3E)& 1-182(CD3G) of human CD3 epsilon&CD3 gamma Heterodimer.
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Application Data

(Human peripheral blood lymphocytes stained with CD3E+CD3G Rabbit mAb (AAA282846) (1ug/mL) (orange). Secondary antibody only staining (Blue) and unstained sample (red) were used as a control.)

product-image-AAA282846_AD11.jpg Application Data (Human peripheral blood lymphocytes stained with CD3E+CD3G Rabbit mAb (AAA282846) (1ug/mL) (orange). Secondary antibody only staining (Blue) and unstained sample (red) were used as a control.)

FCM/FACS (Flow Cytometry)

(Flow cytometric analysis of CD3E+CD3G Rabbit mAb (AAA282846) (1ug/mL) in Jurkats cells (orange) compare to rabbit IgG Isotype control (blue) and non-staining control (Red).)

product-image-AAA282846_FCM13.jpg FCM/FACS (Flow Cytometry) (Flow cytometric analysis of CD3E+CD3G Rabbit mAb (AAA282846) (1ug/mL) in Jurkats cells (orange) compare to rabbit IgG Isotype control (blue) and non-staining control (Red).)

WB (Western Blot)

(Western blot analysis of various lysates, using CD3E+CD3G Rabbit mAb (AAA282846) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA282846_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using CD3E+CD3G Rabbit mAb (AAA282846) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-CD3(epsilon+gamma)/CD3E+CD3G antibody
The protein encoded by this gene is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women. The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 23kDa
Observed MW: 23kDa
UniProt Protein Name
T-cell surface glycoprotein CD3 epsilon chain
UniProt Gene Name
CD3E
UniProt Synonym Gene Names
T3E
UniProt Entry Name
CD3E_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD3(epsilon+gamma)/CD3E+CD3G cd3e (Catalog #AAA282846) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD3E+CD3G Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD3E+CD3G can be used in a range of immunoassay formats including, but not limited to, ELISA, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the CD3(epsilon+gamma)/CD3E+CD3G cd3e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQSGTHWRVL GLCLLSVGVW GQDGNEEMGG ITQTPYKVSI SGTTVILTCP QYPGSEILWQ HNDKNIGGDE DDKNIGSDED HLSLKEFSEL EQSGYYVCYP RGSKPEDANF YLYLRARVCE NCMEMDVMSV ATIVIVDICI TGGLLLLVYY WSKNRKAKAK PVTRGAGAGG RQRGQNKERP PPVPNPDYEP IRKGQRDLYS GLNQRRI(CD 3E)&MEQGKG LAVLILAIIL LQGTLAQSIK GNHLVKVYDY QEDGSVLLTC DAEAKNITWF KDGKMIGFLT EDKKKWNLGS NAKDPRGMYQ CKGSQNKSKP LQVYYRMCQN CIELNAATIS GFLFAEIVSI FVLAVGVYFI AGQDGVRQSR ASDKQTLLPN DQLYQPLKDR EDDQYSHLQG NQLRRN(CD3 G). It is sometimes possible for the material contained within the vial of "CD3E+CD3G, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.