Mouse CDC2 Monoclonal Antibody | anti-CDC2 antibody

CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (PE)

Cat. Num. AAA26589

• Gene Names: CDK1; CDC2; CDC28A; P34CDC2
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: CDC2, Antibody; CDC2 (Cell Division Cycle 2, G1 to S and G2 to M, CDC28A, CDK1, DKFZp686L20222, MGC111195) (PE); Cell Division Cycle 2; G1 to S and G2 to M; CDC28A; CDK1; DKFZp686L20222; MGC111195; anti-CDC2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1
• Clone Number: 1G10
• Specificity: Recognizes CDC2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 297

• Applicable Applications for anti-CDC2 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CDC2 (AAH14563, 211aa-297aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CDC2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CDC2 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in Raw 264.7.)

WB (Western Blot)

(CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in PC-12.)

WB (Western Blot)

(CDC2 monoclonal antibody (M03), clone 1G10. Western Blot analysis of CDC2 expression in NIH/3T3.)

WB (Western Blot)

(CDC2 monoclonal antibody (M03), clone 1G10 Western Blot analysis of CDC2 expression in Hela S3 NE (Cat # L013V3).)

Related Product Information for anti-CDC2 antibody

The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-CDC2 antibody

Antibodies; Cell Division Cycle (CDC)

NCBI and Uniprot Product Information

• NCBI GI #: 15778967
• NCBI GeneID: 983
• NCBI Official Full Name: Cell division cycle 2, G1 to S and G2 to M
• NCBI Official Synonym Full Names: cyclin dependent kinase 1
• NCBI Official Symbol: CDK1
• NCBI Official Synonym Symbols: CDC2; CDC28A; P34CDC2
• NCBI Protein Information: cyclin-dependent kinase 1