Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283015_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from wild type(WT) and CDK5 knockout (KO) 293T cells, using [KO Validated] CDK5 Rabbit mAb (AAA283015) at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

Rabbit anti-Human CDK5 Monoclonal Antibody | anti-CDK5 antibody

[KO Validated] CDK5 Rabbit mAb

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
CDK5, Antibody; [KO Validated] CDK5 Rabbit mAb; LIS7; PSSALRE; K5; anti-CDK5 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF
Applicable Applications for anti-CDK5 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 92-289 of human CDK5. (NP_004926.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of lysates from wild type(WT) and CDK5 knockout (KO) 293T cells, using [KO Validated] CDK5 Rabbit mAb (AAA283015) at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA283015_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from wild type(WT) and CDK5 knockout (KO) 293T cells, using [KO Validated] CDK5 Rabbit mAb (AAA283015) at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of various lysates, using [KO Validated] CDK5 Rabbit mAb (AAA283015) at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA283015_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using [KO Validated] CDK5 Rabbit mAb (AAA283015) at1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-CDK5 antibody
This gene encodes a proline-directed serine/threonine kinase that is a member of the cyclin-dependent kinase family of proteins. Unlike other members of the family, the protein encoded by this gene does not directly control cell cycle regulation. Instead the protein, which is predominantly expressed at high levels in mammalian postmitotic central nervous system neurons, functions in diverse processes such as synaptic plasticity and neuronal migration through phosphorylation of proteins required for cytoskeletal organization, endocytosis and exocytosis, and apoptosis. In humans, an allelic variant of the gene that results in undetectable levels of the protein has been associated with lethal autosomal recessive lissencephaly-7. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 33kDa
Observed MW: 33kDa
UniProt Protein Name
Cyclin-dependent kinase 5
UniProt Gene Name
CDK5
UniProt Synonym Gene Names
CDKN5; TPKII catalytic subunit
UniProt Entry Name
CDK5_HUMAN

Similar Products

Product Notes

The CDK5 cdk5 (Catalog #AAA283015) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] CDK5 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK5 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the CDK5 cdk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DSCNGDLDPE IVKSFLFQLL KGLGFCHSRN VLHRDLKPQN LLINRNGELK LADFGLARAF GIPVRCYSAE VVTLWYRPPD VLFGAKLYST SIDMWSAGCI FAELANAGRP LFPGNDVDDQ LKRIFRLLGT PTEEQWPSMT KLPDYKPYPM YPATTSLVNV VPKLNATGRD LLQNLLKCNP VQRISAEEAL QHPYFSDF. It is sometimes possible for the material contained within the vial of "CDK5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.