Loading...

Skip to main content
WB (Western Blot) (CFL1 monoclonal antibody. Western Blot analysis of CFL1 expression in PC-12.)

Mouse anti-Human, Mouse CFL1 Monoclonal Antibody | anti-CFL1 antibody

CFL1 (Cofilin-1, Cofilin, Non-muscle Isoform, 18kD Phosphoprotein, p18, CFL) APC

Gene Names
CFL1; CFL; cofilin; HEL-S-15
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CFL1, Antibody; CFL1 (Cofilin-1, Cofilin, Non-muscle Isoform, 18kD Phosphoprotein, p18, CFL) APC; anti-CFL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A1
Specificity
Recognizes human CFL1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-CFL1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-166 from human CFL1 (AAH11005) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFAKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEGVKDRCTLAEKLGGSAVISLEGKPL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(CFL1 monoclonal antibody. Western Blot analysis of CFL1 expression in PC-12.)

WB (Western Blot) (CFL1 monoclonal antibody. Western Blot analysis of CFL1 expression in PC-12.)

WB (Western Blot)

(CFL1 monoclonal antibody. Western Blot analysis of CFL1 expression in Raw 264.7.)

WB (Western Blot) (CFL1 monoclonal antibody. Western Blot analysis of CFL1 expression in Raw 264.7.)

Application Data

(Detection limit for recombinant GST tagged CFL1 is ~10ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged CFL1 is ~10ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CFL1 on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CFL1 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1.5ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CFL1 on formalin-fixed paraffin-embedded human breast cancer. [antibody concentration 1.5ug/ml].)

WB (Western Blot)

(CFL1 monoclonal antibody. Western Blot analysis of CFL1 expression in NIH/3T3.)

WB (Western Blot) (CFL1 monoclonal antibody. Western Blot analysis of CFL1 expression in NIH/3T3.)

WB (Western Blot)

(Western Blot detection against Immunogen (44kD).)

WB (Western Blot) (Western Blot detection against Immunogen (44kD).)
Product Categories/Family for anti-CFL1 antibody
References
1. Identification of phosphorylated serine-15 and -82 residues of HSPB1 in 5-fluorouracil- resistant colorectal cancer cells by proteomics. Sakai A, Otani M, Miyamoto A, Yoshida H, Furuya E, Tanigawa N.Journal of Proteomics (2011), doi: 10.1016/j.jprot.2011.09.023. 2. Overexpression of cofilin 1 can predict progression-free survival in patients with epithelial ovarian cancer receiving standard therapy. Nishimura S, Tsuda H, Kataoka F, Arao T, Nomura H, Chiyoda T, Susumu N, Nishio K, Aoki D.Hum Pathol. 2011 Jan 13.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
18,502 Da
NCBI Official Full Name
Homo sapiens cofilin 1 (non-muscle), mRNA
NCBI Official Synonym Full Names
cofilin 1
NCBI Official Symbol
CFL1
NCBI Official Synonym Symbols
CFL; cofilin; HEL-S-15
NCBI Protein Information
cofilin-1

Similar Products

Product Notes

The CFL1 (Catalog #AAA24464) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CFL1 (Cofilin-1, Cofilin, Non-muscle Isoform, 18kD Phosphoprotein, p18, CFL) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CFL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CFL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CFL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.