<
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using cGAS Mouse mAb (AAA283089) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
Mouse anti-Human cGAS Monoclonal Antibody | anti-CGAS antibody
cGAS Mouse mAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
cGAS, Antibody; cGAS Mouse mAb; MB21D1; h-cGAS; C6orf150; anti-CGAS antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a kappa
Purity/Purification
Affinity purification
Sequence
MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSRQKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSAP
Applicable Applications for anti-CGAS antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human cGAS (Q8N884).
Preparation and Storage
Store at 4 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using cGAS Mouse mAb (AAA283089) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using cGAS Mouse mAb (AAA283089) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using cGAS Mouse mAb (AAA283089) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using cGAS Mouse mAb (AAA283089) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using cGAS Mouse mAb (AAA283089) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using cGAS Mouse mAb (AAA283089) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of various lysates using cGAS Mouse mAb (AAA283089) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 20s.)
WB (Western Blot)
(Western blot analysis of various lysates using cGAS Mouse mAb (AAA283089) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 20s.)
Related Product Information for anti-CGAS antibody
Enables several functions, including 2', 3'-cyclic GMP-AMP synthase activity; chromatin binding activity; and phosphatidylinositol-4, 5-bisphosphate binding activity. Involved in several processes, including cellular response to exogenous dsRNA; positive regulation of intracellular signal transduction; and regulation of defense response. Located in several cellular components, including cytosol; nucleus; and site of double-strand break.
Product Categories/Family for anti-CGAS antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 59kDa
Observed MW: 63kDa
Observed MW: 63kDa
UniProt Protein Name
Cyclic GMP-AMP synthase
UniProt Gene Name
MB21D1
UniProt Synonym Gene Names
C6orf150; cGAMP synthase; cGAS; h-cGAS
UniProt Entry Name
CGAS_HUMAN
Similar Products
Product Notes
The CGAS mb21d1 (Catalog #AAA283089) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The cGAS Mouse mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's cGAS can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CGAS mb21d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQPWHGKAMQ RASEAGATAP KASARNARGA PMDPTESPAA PEAALPKAGK FGPARKSGSR QKKSAPDTQE RPPVRATGAR AKKAPQRAQD TQPSDATSAP. It is sometimes possible for the material contained within the vial of "cGAS, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.