<
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Mouse brain using CHD4 Rabbit mAb (AAA283017) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
Rabbit anti-Human CHD4 Monoclonal Antibody | anti-CHD4 antibody
CHD4 Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CHD4, Antibody; CHD4 Rabbit mAb; CHD-4; Mi-2b; SIHIWES; Mi2-BETA; CHD4; anti-CHD4 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
ELAEVEENKKMSQPGSPSPKTPTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETPKDLNDEKQKKNIKQRFMFNI
Applicable Applications for anti-CHD4 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1520-1700 of human CHD4. (NP_001264.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Mouse brain using CHD4 Rabbit mAb (AAA283017) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemistry)
(Immunohistochemistry analysis of paraffin-embedded Mouse brain using CHD4 Rabbit mAb (AAA283017) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human spleen using CHD4 Rabbit mAb (AAA283017) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human spleen using CHD4 Rabbit mAb (AAA283017) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human liver using CHD4 Rabbit mAb (AAA283017) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human liver using CHD4 Rabbit mAb (AAA283017) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from HeLa cells using CHD4 Rabbit mAb (AAA283017) at 1:20000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
WB (Western Blot)
(Western blot analysis of lysates from HeLa cells using CHD4 Rabbit mAb (AAA283017) at 1:20000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-CHD4 antibody
The product of this gene belongs to the SNF2/RAD54 helicase family. It represents the main component of the nucleosome remodeling and deacetylase complex and plays an important role in epigenetic transcriptional repression. Patients with dermatomyositis develop antibodies against this protein. Somatic mutations in this gene are associated with serous endometrial tumors. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-CHD4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 218kDa
Observed MW: 260kDa
Observed MW: 260kDa
UniProt Protein Name
Chromodomain-helicase-DNA-binding protein 4
UniProt Gene Name
CHD4
UniProt Synonym Gene Names
CHD-4
UniProt Entry Name
CHD4_HUMAN
Similar Products
Product Notes
The CHD4 chd4 (Catalog #AAA283017) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHD4 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CHD4 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CHD4 chd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ELAEVEENKK MSQPGSPSPK TPTPSTPGDT QPNTPAPVPP AEDGIKIEEN SLKEEESIEG EKEVKSTAPE TAIECTQAPA PASEDEKVVV EPPEGEEKVE KAEVKERTEE PMETEPKGAA DVEKVEEKSA IDLTPIVVED KEEKKEEEEK KEVMLQNGET PKDLNDEKQK KNIKQRFMFN I. It is sometimes possible for the material contained within the vial of "CHD4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.