Loading...

Skip to main content
WB (Western Blot) (CLK3 monoclonal antibody. Western Blot analysis of CLK3 expression in Hela NE.)

Mouse anti-Human CLK3 Monoclonal Antibody | anti-CLK3 antibody

CLK3 (Dual Specificity Protein Kinase CLK3, CDC-like Kinase 3) (HRP)

Gene Names
CLK3; PHCLK3; PHCLK3/152
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CLK3, Antibody; CLK3 (Dual Specificity Protein Kinase CLK3, CDC-like Kinase 3) (HRP); anti-CLK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F10
Specificity
Recognizes human CLK3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-CLK3 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 0.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa36-136 from human CLK3 (AAH02555) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(CLK3 monoclonal antibody. Western Blot analysis of CLK3 expression in Hela NE.)

WB (Western Blot) (CLK3 monoclonal antibody. Western Blot analysis of CLK3 expression in Hela NE.)

WB (Western Blot)

(Western blot analysis of CLK3 over-expressed 293 cell line, cotransfected with CLK3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CLK3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of CLK3 over-expressed 293 cell line, cotransfected with CLK3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CLK3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CLK3 on HeLa cell. [antibody concentration 8ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CLK3 on HeLa cell. [antibody concentration 8ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CLK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.5ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CLK3 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.5ug/ml].)

WB (Western Blot)

(Western Blot analysis of CLK3 expression in transfected 293T cell line by CLK3 monoclonal antibody. Lane 1: CLK3 transfected lysate (58.6kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of CLK3 expression in transfected 293T cell line by CLK3 monoclonal antibody. Lane 1: CLK3 transfected lysate (58.6kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Product Categories/Family for anti-CLK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56,207 Da
NCBI Official Full Name
Homo sapiens CDC-like kinase 3, mRNA
NCBI Official Synonym Full Names
CDC like kinase 3
NCBI Official Symbol
CLK3
NCBI Official Synonym Symbols
PHCLK3; PHCLK3/152
NCBI Protein Information
dual specificity protein kinase CLK3

Similar Products

Product Notes

The CLK3 (Catalog #AAA25354) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CLK3 (Dual Specificity Protein Kinase CLK3, CDC-like Kinase 3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CLK3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 0.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CLK3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CLK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.