WB (Western Blot)
(Western blot analysis of lysates from Rat lung, using CMTM6 Rabbit mAb (AAA282909) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
Rabbit anti-Human CMTM6 Monoclonal Antibody | anti-CMTM6 antibody
CMTM6 Rabbit mAb
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
CMTM6, Antibody; CMTM6 Rabbit mAb; CKLFSF6; PRO2219; CMTM6; anti-CMTM6 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
LILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLASIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFITMLYEKRQESQLRKPENTTRAEALTEPLNA
Applicable Applications for anti-CMTM6 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 84-183 of human CMTM6 (NP_060271.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of lysates from Rat lung, using CMTM6 Rabbit mAb (AAA282909) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of lysates from Rat lung, using CMTM6 Rabbit mAb (AAA282909) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of various lysates using CMTM6 Rabbit mAb (AAA282909) at1:20000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of various lysates using CMTM6 Rabbit mAb (AAA282909) at1:20000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
Related Product Information for anti-CMTM6 antibody
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.
Product Categories/Family for anti-CMTM6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 20kDa
Observed MW: 20-22kDa
Observed MW: 20-22kDa
UniProt Protein Name
CKLF-like MARVEL transmembrane domain-containing protein 6
UniProt Gene Name
CMTM6
UniProt Synonym Gene Names
CKLFSF6
UniProt Entry Name
CKLF6_HUMAN
Similar Products
Product Notes
The CMTM6 cmtm6 (Catalog #AAA282909) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CMTM6 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CMTM6 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the CMTM6 cmtm6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LILIVYCTPF YERVDTTKVK SSDFYITLGT GCVFLLASII FVSTHDRTSA EIAAIVFGFI ASFMFLLDFI TMLYEKRQES QLRKPENTTR AEALTEPLNA. It is sometimes possible for the material contained within the vial of "CMTM6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.