Rabbit anti-Mouse Complement C3 Monoclonal Antibody | anti-C3 antibody

Complement C3 Rabbit mAb

Cat. Num. AAA282948

• Reactivity: Mouse
• Applications: ELISA, Western Blot
• Purity: Affinity purification
• Synonyms: Complement C3, Antibody; Complement C3 Rabbit mAb; ASP; Plp; HSE-MSF; Complement C3; anti-C3 antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: RVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN

• Applicable Applications for anti-C3 antibody: ELISA, WB (Western Blot)
• Cross Reactivity: Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1364-1663 of mouse Complement C3 (NP_033908.2).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of various lysates, using Complement C3 Rabbit mAb (AAA282948) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse liver, using Complement C3 Rabbit mAb (AAA282948) at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

Related Product Information for anti-C3 antibody

This gene encodes complement protein C3 which plays a central role in the classical, alternative and lectin activation pathways of the complement system. The encoded preproprotein undergoes a multi-step processing to generate various functional peptides. Mice deficient in the encoded protein fail to clear bacteria from the blood stream upon infection, display diminished airway hyperresponsiveness and lung eosinophilia upon allergen-induced pulmonary allergy, and develop severe lung injury after deposition of IgG immune complexes. Deficiency of the homolog of the encoded protein in humans was found to be associated with increased susceptibility to infections, age-related macular degeneration, and atypical hemolytic uremic syndrome.

Product Categories/Family for anti-C3 antibody

Signal Transduction; G protein signaling; G-Protein-Coupled Receptors(GPCR); Immunology & Inflammation; Cell Intrinsic Innate Immunity Signaling Pathway; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 126518317
• NCBI GeneID: 12266
• NCBI Accession #: NP_033908.2
• NCBI GenBank Nucleotide #: NM_009778.2
• UniProt Accession #: P01027; Q61370; Q80XP1
• Molecular Weight: Calculated MW: 186kDa; Observed MW: 115kDa/187kDa
• UniProt Protein Name: Complement C3
• UniProt Gene Name: C3
• UniProt Synonym Gene Names: C3bc; ASP
• UniProt Entry Name: CO3_MOUSE