Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283085_WB11.jpg WB (Western Blot) (Western blot analysis of various lysates using Complement C3 Rabbit PolymAb® (AAA283085) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

Rabbit anti-Human, Mouse Complement C3 Monoclonal Antibody | anti-C3 antibody

Complement C3 Rabbit PolymAb

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
Complement C3, Antibody; Complement C3 Rabbit PolymAb; ASP; C3a; C3b; AHUS5; ARMD9; CPAMD1; HEL-S-62p; anti-C3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
RVSIRPAPETAKKPEEAKNTMFLEICTKYLGDVDATMSILDISMMTGFAPDTKDLELLASGVDRYISKYEMNKAFSNKNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDGMLSKLCHSEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTELTNIELLDDFDEYTMTIQQVIKSGSDEVQAGQQRKFISHIKCRNALKLQKGKKYLMWGLSSDLWGEKPNTSYIIGKDTWVEHWPEAEECQDQKYQKQCEELGAFTESMVVYGCPN
Applicable Applications for anti-C3 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1364-1663 of human/mouse Complement C3 (NP_033908.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

WB (Western Blot)

(Western blot analysis of various lysates using Complement C3 Rabbit PolymAb® (AAA283085) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

product-image-AAA283085_WB11.jpg WB (Western Blot) (Western blot analysis of various lysates using Complement C3 Rabbit PolymAb® (AAA283085) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse liver using Complement C3 Rabbit PolymAb® (AAA283085) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA283085_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse liver using Complement C3 Rabbit PolymAb® (AAA283085) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

WB (Western Blot)

(Western blot analysis of lysates from Hep G2 cells using Complement C3 Rabbit PolymAb® (AAA283085) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

product-image-AAA283085_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Hep G2 cells using Complement C3 Rabbit PolymAb® (AAA283085) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
Related Product Information for anti-C3 antibody
Complement component C3 plays a central role in the activation of complement system. Its activation is required for both classical and alternative complement activation pathways. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form the mature protein, which is then further processed to generate numerous peptide products. The C3a peptide, also known as the C3a anaphylatoxin, modulates inflammation and possesses antimicrobial activity. Mutations in this gene are associated with atypical hemolytic uremic syndrome and age-related macular degeneration in human patients.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 186kDa
UniProt Protein Name
Complement C3
UniProt Gene Name
C3
UniProt Synonym Gene Names
CPAMD1; ASP
UniProt Entry Name
CO3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The C3 c3 (Catalog #AAA283085) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Complement C3 Rabbit PolymAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Complement C3 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the C3 c3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RVSIRPAPET AKKPEEAKNT MFLEICTKYL GDVDATMSIL DISMMTGFAP DTKDLELLAS GVDRYISKYE MNKAFSNKNT LIIYLEKISH TEEDCLTFKV HQYFNVGLIQ PGSVKVYSYY NLEESCTRFY HPEKDDGMLS KLCHSEMCRC AEENCFMQQS QEKINLNVRL DKACEPGVDY VYKTELTNIE LLDDFDEYTM TIQQVIKSGS DEVQAGQQRK FISHIKCRNA LKLQKGKKYL MWGLSSDLWG EKPNTSYIIG KDTWVEHWPE AEECQDQKYQ KQCEELGAFT ESMVVYGCPN. It is sometimes possible for the material contained within the vial of "Complement C3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.