Mouse anti-Human CRYM Monoclonal Antibody | anti-CRYM antibody

CRYM (Thiomorpholine-carboxylate Dehydrogenase, Mu-crystallin Homolog, NADP-regulated Thyroid-hormone-binding Protein, Ketimine Reductase, THBP) (AP)

Cat. Num. AAA24177

• Gene Names: CRYM; THBP; DFNA40
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRYM, Antibody; CRYM (Thiomorpholine-carboxylate Dehydrogenase, Mu-crystallin Homolog, NADP-regulated Thyroid-hormone-binding Protein, Ketimine Reductase, THBP) (AP); anti-CRYM antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6B3
• Specificity: Recognizes human CRYM.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-CRYM antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa215-314 from human CRYM (NP_001879) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

Product Categories/Family for anti-CRYM antibody

Antibodies; Enzymes; Dehydrogenase

References

1. The FSHD Atrophic Myotube Phenotype Is Caused by DUX4 Expression. Vanderplanck C, Ansseau E, Charron S, Stricwant N, Tassin A, Laoudj-Chenivesse D, Wilton SD, Coppee F, Belayew A.PLoS One. 2011;6(10):e26820. Epub 2011 Oct 28. 2. Proteomic Analysis Illuminates a Novel Structural Definition of the Claustrum and Insula. Mathur BN, Caprioli RM, Deutch AY.Cereb Cortex. 2009 Oct;19(10):2372-9. Epub 2009 Jan 23. 3. Abnormal expression of mu-crystallin in facioscapulohumeral muscular dystrophy. Reed PW, Corse AM, Porter NC, Flanigan KM, Bloch RJ.Exp Neurol. 2007 Jun;205(2):583-6. Epub 2007 Mar 21.

NCBI and Uniprot Product Information

• NCBI GI #: 4503065
• NCBI GeneID: 1428
• NCBI Accession #: NP_001879
• NCBI GenBank Nucleotide #: NM_001888
• UniProt Accession #: Q14894; Q5HYB7; D5MNX0
• Molecular Weight: 35.9 kDa (334aa), confirmed by MALDI-TOF
• NCBI Official Full Name: ketimine reductase mu-crystallin
• NCBI Official Synonym Full Names: crystallin mu
• NCBI Official Symbol: CRYM
• NCBI Official Synonym Symbols: THBP; DFNA40
• NCBI Protein Information: ketimine reductase mu-crystallin
• UniProt Protein Name: Ketimine reductase mu-crystallin
• UniProt Gene Name: CRYM
• UniProt Synonym Gene Names: THBP
• UniProt Entry Name: CRYM_HUMAN