Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24178_WB7.jpg WB (Western Blot) (CSK monoclonal antibody. Western Blot analysis of CSK expression in Hela NE.)

Mouse anti-Human CSK Monoclonal Antibody | anti-CSK antibody

CSK (Tyrosine-protein Kinase CSK, C-SRC Kinase, Protein-tyrosine Kinase CYL) (AP)

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CSK, Antibody; CSK (Tyrosine-protein Kinase CSK, C-SRC Kinase, Protein-tyrosine Kinase CYL) (AP); anti-CSK antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3A3
Specificity
Recognizes human CSK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CSK antibody
ELISA, IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
IHC-P: 1ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human CSK (NP_004374) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(CSK monoclonal antibody. Western Blot analysis of CSK expression in Hela NE.)

product-image-AAA24178_WB7.jpg WB (Western Blot) (CSK monoclonal antibody. Western Blot analysis of CSK expression in Hela NE.)

WB (Western Blot)

(Western Blot analysis of CSK expression in transfected 293T cell line by CSK monoclonal antibody. Lane 1: CSK transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)

product-image-AAA24178_WB6.jpg WB (Western Blot) (Western Blot analysis of CSK expression in transfected 293T cell line by CSK monoclonal antibody. Lane 1: CSK transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western blot analysis of CSK over-expressed 293 cell line, cotransfected with CSK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA24178_WB5.jpg WB (Western Blot) (Western blot analysis of CSK over-expressed 293 cell line, cotransfected with CSK Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CSK monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CSK is ~0.1ng/ml as a capture antibody.)

product-image-AAA24178_APP4.jpg Application Data (Detection limit for recombinant GST tagged CSK is ~0.1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of CSK transfected lysate using CSK monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CSK rabbit polyclonal antibody.)

product-image-AAA24178_IP3.jpg IP (Immunoprecipitation) (Immunoprecipitation of CSK transfected lysate using CSK monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CSK rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

product-image-AAA24178_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1ug/ml].)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

product-image-AAA24178_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Product Categories/Family for anti-CSK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
tyrosine-protein kinase CSK
NCBI Official Synonym Full Names
C-terminal Src kinase
NCBI Official Symbol
CSK
NCBI Protein Information
tyrosine-protein kinase CSK
UniProt Protein Name
Tyrosine-protein kinase CSK
UniProt Gene Name
CSK
UniProt Entry Name
CSK_HUMAN

Similar Products

Product Notes

The CSK csk (Catalog #AAA24178) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CSK (Tyrosine-protein Kinase CSK, C-SRC Kinase, Protein-tyrosine Kinase CYL) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSK can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). IHC-P: 1ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSK csk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSK, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.