Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25067_WB6.jpg WB (Western Blot) (CSNK2A1 monoclonal antibody, Western Blot analysis of CSNK2A1 expression in Hela NE.)

Mouse anti-Human CSNK2A1 Monoclonal Antibody | anti-CSNK2A1 antibody

CSNK2A1 (Casein Kinase II Subunit alpha, CK II alpha, CK2A1) (FITC)

Gene Names
CSNK2A1; CKII; CK2A1; OCNDS; CSNK2A3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CSNK2A1, Antibody; CSNK2A1 (Casein Kinase II Subunit alpha, CK II alpha, CK2A1) (FITC); anti-CSNK2A1 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D9
Specificity
Recognizes human CSNK2A1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-CSNK2A1 antibody
ELISA, IF (Immunofluorescence), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from human CSNK2A1 (AAH11668) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(CSNK2A1 monoclonal antibody, Western Blot analysis of CSNK2A1 expression in Hela NE.)

product-image-AAA25067_WB6.jpg WB (Western Blot) (CSNK2A1 monoclonal antibody, Western Blot analysis of CSNK2A1 expression in Hela NE.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and CSNK2A1 HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and CSNK2A1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

product-image-AAA25067_APP5.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between TP53 and CSNK2A1 HeLa cells were stained with TP53 rabbit purified polyclonal 1:1200 and CSNK2A1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged CSNK2A1 is ~3ng/ml as a capture antibody.)

product-image-AAA25067_APP4.jpg Application Data (Detection limit for recombinant GST tagged CSNK2A1 is ~3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CSNK2A1 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA25067_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CSNK2A1 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of CSNK2A1 expression in transfected 293T cell line by CSNK2A1 monoclonal antibody. Lane 1: CSNK2A1 transfected lysate (45.1kD). Lane 2: Non-transfected lysate.)

product-image-AAA25067_WB2.jpg WB (Western Blot) (Western Blot analysis of CSNK2A1 expression in transfected 293T cell line by CSNK2A1 monoclonal antibody. Lane 1: CSNK2A1 transfected lysate (45.1kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.63kD).)

product-image-AAA25067_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.63kD).)
Product Categories/Family for anti-CSNK2A1 antibody
References
1. CK2 Inhibitors Enhance the Radiosensitivity of Human Non-Small Cell Lung Cancer Cells Through Inhibition of Stat3 Activation. Lin YC, Hung MS, Lin CK, Li JM, Lee KD, Li YC, Chen MF, Chen JK, Yang CT.Cancer Biother Radiopharm. 2011 Jun;26(3):381-8. Epub 2011 Jun 28.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
29,181 Da
NCBI Official Full Name
Homo sapiens casein kinase 2, alpha 1 polypeptide, mRNA
NCBI Official Synonym Full Names
casein kinase 2 alpha 1
NCBI Official Symbol
CSNK2A1
NCBI Official Synonym Symbols
CKII; CK2A1; OCNDS; CSNK2A3
NCBI Protein Information
casein kinase II subunit alpha

Similar Products

Product Notes

The CSNK2A1 (Catalog #AAA25067) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CSNK2A1 (Casein Kinase II Subunit alpha, CK II alpha, CK2A1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK2A1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSNK2A1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSNK2A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.