Loading...

Skip to main content
WB (Western Blot) (Western Blot analysis of CTNS expression in PC-12.)

Mouse Cystinosin Monoclonal Antibody | anti-CTNS antibody

Cystinosin (CTNS) (AP)

Gene Names
CTNS; PQLC4; SLC66A4; CTNS-LSB
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cystinosin, Antibody; Cystinosin (CTNS) (AP); anti-CTNS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5G6
Specificity
Recognizes human Cystinosin. Species Crossreactivity: mouse, rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
367
Applicable Applications for anti-CTNS antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-100 of human Cystinosin with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MIRNWLTIFILFPLKLVEKCESSVSLTVPPVVKLENGSSTNVSLTLRPPLNATLVITFEITFRSKNITILELPDEVVVPPGVTNSSFQVTSQNVGQLTVY
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of CTNS expression in PC-12.)

WB (Western Blot) (Western Blot analysis of CTNS expression in PC-12.)

WB (Western Blot)

(Western Blot detection against immunogen using (36.74kD).)

WB (Western Blot) (Western Blot detection against immunogen using (36.74kD).)

WB (Western Blot)

(Western Blot analysis of CTNS expression in Raw 264.7)

WB (Western Blot) (Western Blot analysis of CTNS expression in Raw 264.7)

WB (Western Blot)

(Western Blot analysis of CTNS expression in HepG2)

WB (Western Blot) (Western Blot analysis of CTNS expression in HepG2)

WB (Western Blot)

(Western Blot analysis of CTNS expression in human liver)

WB (Western Blot) (Western Blot analysis of CTNS expression in human liver)

Application Data

(Detection limit is ~0.3ng/ml using as a capture antibody.)

Application Data (Detection limit is ~0.3ng/ml using as a capture antibody.)
Related Product Information for anti-CTNS antibody
This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CTNS antibody
References
1. Modulation of CTNS Gene Expression By Intracellular Thiols. Bellomo F, Corallini S, Pastore A, Palma A, Laurenzi C, Emma F, Taranta A.Free Radic Biol Med. 2010 Jan 14.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
cystinosin isoform 2
NCBI Official Synonym Full Names
cystinosin, lysosomal cystine transporter
NCBI Official Symbol
CTNS
NCBI Official Synonym Symbols
PQLC4; SLC66A4; CTNS-LSB
NCBI Protein Information
cystinosin
UniProt Protein Name
Cystinosin
UniProt Gene Name
CTNS
UniProt Entry Name
CTNS_HUMAN

Similar Products

Product Notes

The CTNS ctns (Catalog #AAA24183) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Cystinosin (CTNS) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cystinosin can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTNS ctns for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cystinosin, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.