Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282725_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat eyeball tissue using Cytokeratin 12 (KRT12) Rabbit mAb (AAA282725, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

Rabbit anti-Human Cytokeratin 12 (KRT12) Monoclonal Antibody | anti-KRT12 antibody

Cytokeratin 12 (KRT12) Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
Cytokeratin 12 (KRT12), Antibody; Cytokeratin 12 (KRT12) Rabbit mAb; K12; MECD1; Cytokeratin 12 (KRT12); anti-KRT12 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
EMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM
Applicable Applications for anti-KRT12 antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 250-494 of human Cytokeratin 12 (KRT12)(NP_000214.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Rat eyeball tissue using Cytokeratin 12 (KRT12) Rabbit mAb (AAA282725, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA282725_ICC8.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat eyeball tissue using Cytokeratin 12 (KRT12) Rabbit mAb (AAA282725, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse eyeball tissue using Cytokeratin 12 (KRT12) Rabbit mAb (AAA282725, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA282725_ICC10.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse eyeball tissue using Cytokeratin 12 (KRT12) Rabbit mAb (AAA282725, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

IHC (Immunohistochemisry)

(Immunohistochemistry analysis of paraffin-embedded Mouse cornea using Cytokeratin 12 (KRT12) (KRT12) Rabbit mAb (AAA282725) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA282725_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry analysis of paraffin-embedded Mouse cornea using Cytokeratin 12 (KRT12) (KRT12) Rabbit mAb (AAA282725) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat cornea using Cytokeratin 12 (KRT12) (KRT12) Rabbit mAb (AAA282725) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA282725_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat cornea using Cytokeratin 12 (KRT12) (KRT12) Rabbit mAb (AAA282725) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of lysates from Rat eye, using Cytokeratin 12 (KRT12) Rabbit mAb (AAA282725) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)

product-image-AAA282725_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Rat eye, using Cytokeratin 12 (KRT12) Rabbit mAb (AAA282725) at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 180s.)
Related Product Information for anti-KRT12 antibody
KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 54kDa
Observed MW: 54kDa
UniProt Protein Name
Keratin, type I cytoskeletal 12
UniProt Gene Name
KRT12
UniProt Synonym Gene Names
CK-12; K12
UniProt Entry Name
K1C12_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The KRT12 krt12 (Catalog #AAA282725) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cytokeratin 12 (KRT12) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cytokeratin 12 (KRT12) can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the KRT12 krt12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EMQIESLNEE LAYMKKNHED ELQSFRVGGP GEVSVEMDAA PGVDLTRLLN DMRAQYETIA EQNRKDAEAW FIEKSGELRK EISTNTEQLQ SSKSEVTDLR RAFQNLEIEL QSQLAMKKSL EDSLAEAEGD YCAQLSQVQQ LISNLEAQLL QVRADAERQN VDHQRLLNVK ARLELEIETY RRLLDGEAQG DGLEESLFVT DSKSQAQSTD SSKDPTKTRK IKTVVQEMVN GEVVSSQVQE IEELM. It is sometimes possible for the material contained within the vial of "Cytokeratin 12 (KRT12), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.