Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Mouse Defensin, beta-2 (a.a. 4-41) Monoclonal Antibody | anti-Defb2 antibody

MAb to beta-Defensin-2 (a.a. 4-41)

Gene Names
Defb2; BD-2; MGC129140; MGC129141
Applications
ELISA
Purity
Purified, Lyophilized
Purification: Protein G Chromatography
Synonyms
Defensin, beta-2 (a.a. 4-41), Antibody; MAb to beta-Defensin-2 (a.a. 4-41); MAb to beta-Defensin-2 (a.a. 4-41), Monoclonal Antibody to Human beta-Defensin-2 (amino acids 4-41); anti-Defb2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1
Specificity
Synthetic human beta-Defensin 2 (a.a. 4-41)
Purity/Purification
Purified, Lyophilized
Purification: Protein G Chromatography
Form/Format
Lyophilized from Phopshate Buffered Saline, pH7.4
Concentration
1 mg (Lyophilized) (varies by lot)
Applicable Applications for anti-Defb2 antibody
ELISA (EIA)
Application Notes
Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.
Source
Cell Culture Supernatant
Immunogen
Synthetic human beta-Defensin 2 (a.a. 4-41)(DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP)
Reconstitution
In 1mL double distilled water for a 1mg vial
Important Note
Centrifuge before opening to ensure complete recovery of vial contents.
Preparation and Storage
Store lyophilized product at 2-8°C. After reconstitution, store at -20°C. Avoid multiple freeze/thaw cycles.
Related Product Information for anti-Defb2 antibody
MAb to beta-Defensin-2 (a.a. 4-41)
Monoclonal Antibody to Human beta-Defensin-2 (amino acids 4-41)
Product Categories/Family for anti-Defb2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Defensin beta 2
NCBI Official Synonym Full Names
defensin beta 2
NCBI Official Symbol
Defb2
NCBI Official Synonym Symbols
BD-2; MGC129140; MGC129141
NCBI Protein Information
beta-defensin 2; OTTMUSP00000022725
UniProt Protein Name
Beta-defensin 2
UniProt Gene Name
Defb2
UniProt Entry Name
DEFB2_MOUSE

Similar Products

Product Notes

The Defb2 defb2 (Catalog #AAA13383) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Defensin, beta-2 (a.a. 4-41) can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded. Researchers should empirically determine the suitability of the Defb2 defb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Defensin, beta-2 (a.a. 4-41), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.