Mouse anti-Human, Rat DHFR Monoclonal Antibody | anti-DHFR antibody

DHFR (Dihydrofolate reductase) (PE)

Cat. Num. AAA25667

• Gene Names: DHFR; DYR; DHFRP1
• Reactivity: Human, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DHFR, Antibody; DHFR (Dihydrofolate reductase) (PE); anti-DHFR antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B10
• Specificity: Recognizes human DHFR. Species Crossreactivity: rat
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1133

• Applicable Applications for anti-DHFR antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa88-187 of human DHFR (BC003584; AAH03584) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of DHFR expression in HeLa.)

IF (Immunofluorescence)

(Immunofluorescence on HeLa cells using 125814 (10ug/ml).)

Application Data

(Detection limit for 125814 is ~0.1ng/ml as a capture antibody.)

WB (Western Blot)

(Western Blot analysis of DHFR expression in transfected 293T cell line using 125814. Lane 1: DHFR transfected lysate (21.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot analysis of DHFR expression in PC-12 using 125814.)

WB (Western Blot)

(Western Blot detection against immunogen (36.74kD).)

Related Product Information for anti-DHFR antibody

Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia.

Product Categories/Family for anti-DHFR antibody

Antibodies; Enzymes

References

1. Influence of Reduced Folate Carrier and Dihydrofolate Reductase Genes on Methotrexate-Induced Cytotoxicity. Yoon SA, Choi JR, Kim JO, Shin JY, Zhang X, Kang JH.Cancer Res Treat. 2010 Sep;42(3):163-71. Epub 2010 Sep 30. 2. Telomere capping in non-dividing yeast cells requires Yku and Rap1. Vodenicharov MD, Laterreur N, Wellinger RJ.EMBO J. 2010 Jul 13. 3. Anticancer drug encapsulated in inorganic lattice can overcome drug resistance. Choi SJ, Choi GE, Oh JM, Oh YJ, Park MC, Choy JH.J. Mater. Chem., 2010, 20, 9463-9469. 4. Deficient BH4 production via de novo and salvage pathways regulates NO responses to cytokines in adult cardiac myocytes. Ionova IA, Vasquez-Vivar J, Whitsett J, Herrnreiter A, Medhora M, Cooley BC, Pieper GM.Am J Physiol Heart Circ Physiol. 2008 Nov;295(5):H2178-87. Epub 2008 Oct 3.

NCBI and Uniprot Product Information

• NCBI GI #: 13097773
• NCBI GeneID: 1719
• NCBI Official Full Name: Homo sapiens dihydrofolate reductase, mRNA
• NCBI Official Synonym Full Names: dihydrofolate reductase
• NCBI Official Symbol: DHFR
• NCBI Official Synonym Symbols: DYR; DHFRP1
• NCBI Protein Information: dihydrofolate reductase