Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24487_WB6.jpg WB (Western Blot) (DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in NIH/3T3.)

Mouse DLX5 Monoclonal Antibody | anti-DLX5 antibody

DLX5 (Homeobox Protein DLX-5) APC

Gene Names
DLX5; SHFM1D
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLX5, Antibody; DLX5 (Homeobox Protein DLX-5) APC; anti-DLX5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B11
Specificity
Recognizes human DLX5. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-DLX5 antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa191-279 from human DLX5 (NP_005212) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQH
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in NIH/3T3.)

product-image-AAA24487_WB6.jpg WB (Western Blot) (DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in NIH/3T3.)

WB (Western Blot)

(Western Blot analysis of DLX5 expression in transfected 293T cell line by DLX5 monoclonal antibody (M12). Lane 1: DLX5 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)

product-image-AAA24487_WB5.jpg WB (Western Blot) (Western Blot analysis of DLX5 expression in transfected 293T cell line by DLX5 monoclonal antibody (M12). Lane 1: DLX5 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(DLX5 monoclonal antibody, Western Blot analysis of DLX5 expression in A-431.)

product-image-AAA24487_WB4.jpg WB (Western Blot) (DLX5 monoclonal antibody, Western Blot analysis of DLX5 expression in A-431.)

WB (Western Blot)

(DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in Raw 264.7.)

product-image-AAA24487_WB3.jpg WB (Western Blot) (DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in Raw 264.7.)

WB (Western Blot)

(DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in PC-12.)

product-image-AAA24487_WB2.jpg WB (Western Blot) (DLX5 monoclonal antibody. Western Blot analysis of DLX5 expression in PC-12.)

WB (Western Blot)

(Western Blot detection against Immunogen (35.79kD).)

product-image-AAA24487_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (35.79kD).)
Related Product Information for anti-DLX5 antibody
Transcriptional factor involved in bone development. Acts as an immediate early BMP-responsive transcriptional activator essential for osteoblast differentiation. Stimulates ALPL promoter activity in a RUNX2-independent manner during osteoblast differentiation. Stimulates SP7 promoter activity during osteoblast differentiation. Promotes cell proliferation by up-regulating MYC promoter activity. Involved as a positive regulator of both chondrogenesis and chondrocyte hypertrophy in the endochondral skeleton. Binds to the homeodomain-response element of the ALPL and SP7 promoter. Binds to the MYC promoter. Requires the 5'-TAATTA-3' consensus sequence for DNA-binding.
Product Categories/Family for anti-DLX5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
homeobox protein DLX-5
NCBI Official Synonym Full Names
distal-less homeobox 5
NCBI Official Symbol
DLX5
NCBI Official Synonym Symbols
SHFM1D
NCBI Protein Information
homeobox protein DLX-5
UniProt Protein Name
Homeobox protein DLX-5
UniProt Gene Name
DLX5
UniProt Entry Name
DLX5_HUMAN

Similar Products

Product Notes

The DLX5 dlx5 (Catalog #AAA24487) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DLX5 (Homeobox Protein DLX-5) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DLX5 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLX5 dlx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLX5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.