IP (Immunoprecipitation)
(Immunoprecipitation of DNMT3A from 300 ug extracts of 293T cells was performed using 3 ug of DNMT3A antibody (AAA282782). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNMT3A antibody (AAA282782) at a dilution of 1:1000.)
Rabbit anti-Human DNMT3A Monoclonal Antibody | anti-DNMT3A antibody
[KO Validated] DNMT3A Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
DNMT3A, Antibody; [KO Validated] DNMT3A Rabbit mAb; TBRS; HESJAS; DNMT3A2; M.HsaIIIA; 3A; anti-DNMT3A antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
GNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPSRLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVL
Applicable Applications for anti-DNMT3A antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 550-650 of human DNMT3A (Q9Y6K1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IP (Immunoprecipitation)
(Immunoprecipitation of DNMT3A from 300 ug extracts of 293T cells was performed using 3 ug of DNMT3A antibody (AAA282782). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNMT3A antibody (AAA282782) at a dilution of 1:1000.)
IP (Immunoprecipitation)
(Immunoprecipitation of DNMT3A from 300 ug extracts of 293T cells was performed using 3 ug of DNMT3A antibody (AAA282782). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using DNMT3A antibody (AAA282782) at a dilution of 1:1000.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and DNMT3A knockout (KO) 293T cells using [KO Validated] DNMT3A (AAA282782) at 1:500 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of lysates from wild type (WT) and DNMT3A knockout (KO) 293T cells using [KO Validated] DNMT3A (AAA282782) at 1:500 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse Thymus using DNMT3A Rabbit mAb (AAA282782) at 1:500 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse Thymus using DNMT3A Rabbit mAb (AAA282782) at 1:500 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-DNMT3A antibody
CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.
Product Categories/Family for anti-DNMT3A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 102kDa
Observed MW: 85kDa/95kDa/130kDa
Observed MW: 85kDa/95kDa/130kDa
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 3A
UniProt Gene Name
DNMT3A
UniProt Synonym Gene Names
Dnmt3a; DNA MTase HsaIIIA; M.HsaIIIA
UniProt Entry Name
DNM3A_HUMAN
Similar Products
Product Notes
The DNMT3A dnmt3a (Catalog #AAA282782) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] DNMT3A Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNMT3A can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the DNMT3A dnmt3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GNNNCCRCFC VECVDLLVGP GAAQAAIKED PWNCYMCGHK GTYGLLRRRE DWPSRLQMFF ANNHDQEFDP PKVYPPVPAE KRKPIRVLSL FDGIATGLLV L. It is sometimes possible for the material contained within the vial of "DNMT3A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.