Mouse DYRK1A Monoclonal Antibody | anti-DYRK1A antibody
DYRK1A (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1A, Protein Kinase Minibrain Homolog, MNBH, HP86, Dual Specificity YAK1-related Kinase, hMNB, DYRK, MNB, MNBH) (AP)
Gene Names
DYRK1A; MNB; DYRK; HP86; MNBH; MRD7; DYRK1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DYRK1A, Antibody; DYRK1A (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1A, Protein Kinase Minibrain Homolog, MNBH, HP86, Dual Specificity YAK1-related Kinase, hMNB, DYRK, MNB, MNBH) (AP); anti-DYRK1A antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
7D10
Specificity
Recognizes human DYRK1A. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DYRK1A antibody
ELISA, WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa674-763 from human DYRK1A (NP_001387) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTYQFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-DYRK1A antibody
DYRK1A is a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development. This gene is a homolog of Drosophila mnb (minibrain) gene and rat Dyrk gene. It is localized in the Down syndrome critical region of chromosome 21, and is considered to be a strong candidate gene for learning defects associated with Down syndrome.
Product Categories/Family for anti-DYRK1A antibody
References
1. Mice Deficient in Cystathionine Beta Synthase Display Increased Dyrk1A and SAHH Activities in Brain. Planque C, Dairou J, Noll C, Bui LC, Ripoll C, Guedj F, Delabar JM, Janel N.J Mol Neurosci. 2012 Jun 15. 2. Increased dosage of the chromosome 21 ortholog Dyrk1a promotes megakaryoblastic leukemia in a murine model of Down syndrome. Malinge S, Bliss-Moreau M, Kirsammer G, Diebold L, Chlon T, Gurbuxani S, Crispino JD.J Clin Invest. 2012 Mar 1;122(3):948-62. doi: 10.1172/JCI60455. Epub 2012 Feb 22. 3. DYRK1A: A master regulatory protein controlling brain growth. Guedj F, Pereira PL, Najas S, Barallobre MJ, Chabert C, Souchet B, Sebrie C, Verney C, Herault Y, Arbones M, Delabar JM.Neurobiol Dis. 2012 Jan 26. 4. Loss of correlations among proteins in brains of the Ts65Dn mouse model of down syndrome. Ahmed MM, Sturgeon X, Ellison M, Davisson MT, Gardiner KJ.J Proteome Res. 2012 Feb 3;11(2):1251-63. Epub 2012 Jan 25. 5. Dyrk1A negatively regulates the actin cytoskeleton through threonine phosphorylation of N-WASP. Park J, Sung JY, Park J, Song WJ, Chang S, Chung KC.J Cell Sci. 2012 Jan 1;125(Pt 1):67-80. Epub 2012 Jan 16. 6. Altered regulation of tau phosphorylation in a mouse model of down syndrome aging. Sheppard O, Plattner F, Rubin A, Slender A, Linehan JM, Brandner S, Tybulewicz VL, Fisher EM, Wiseman FK.Neurobiol Aging. 2011 Aug 13. 7. Engineering DYRK1A over-dosage yields Down syndrome-characteristic cortical splicing aberrations. Toiber D, Azkona G, Ben-Ari S, Toran N, Soreq H, Dierssen M.Neurobiol Dis. 2010 Jun 30. 8. DYRK1A and DYRK3 promote cell survival through phosphorylation and activation of SIRT1. Guo X, Williams JG, Schug TT, Li X.J Biol Chem. 2010 Feb 18. 9. Hyperhomocysteinemia-induced Dyrk1a downregulation results in cardiomyocyte hypertrophy in rats. Raaf L, Noll C, Cherifi M, Benazzoug Y, Delabar JM, Janel N.Int J Cardiol. 2009 Nov 9. 10. DYRK1A, a Novel Determinant of the Methionine-Homocysteine Cycle in Different Mouse Models Overexpressing this Down-Syndrome-Associated Kinase Noll C, Planque C, Ripoll C, Guedj F, Diez A, Ducros V, Belin N, Duchon A, Paul JL, Badel A, de Freminville B, Grattau Y, Blehaut H, Herault Y, Janel N, Delabar JM.PLoS One. 2009 Oct 21;4(10):e7540. 11. Negative Feedback Inhibition of NFATc1 by DYRK1A Regulates Bone Homeostasis. Lee Y, Ha J, Kim HJ, Kim YS, Chang EJ, Song WJ, Kim HH.J Biol Chem. 2009 Nov 27;284(48):33343-51. Epub 2009 Oct 2. 12. Nonprimed and DYRK1A-primed GSK3?]-phosphorylation sites on MAP1B regulate microtubule dynamics in growing axons. Scales TM, Lin S, Kraus M, Goold RG, Gordon-Weeks PR.J Cell Sci. 2009 Jul 15;122(Pt 14):2424-35. Epub 2009 Jun 23. 13. Green Tea Polyphenols Rescue of Brain Defects Induced by Overexpression of DYRK1A. Guedj F, Sebrie C, Rivals I, Ledru A, Paly E, Bizot JC, Smith D, Rubin E, Gillet B, Arbones M, Delabar JM.PLoS One. 2009;4(2):e4606. Epub 2009 Feb 26. 14. Effect of hyperhomocysteinemia on the protein kinase DYRK1A in liver of mice. Hamelet J, Noll C, Ripoll C, Paul JL, Janel N, Delabar JM.Biochem Biophys Res Commun. 2009 Jan 16;378(3):673-7. Epub 2008 Dec 6. 15. Sprouty2 inhibitory activity on FGF-signaling is modulated by the protein kinase DYRK1A. Aranda S, Alvarez M, Turro S, Laguna A, de la Luna S.Mol Cell Biol. 2008 Oct;28(19):5899-911. Epub 2008 Aug 4.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66,099 Da
NCBI Official Full Name
dual specificity tyrosine-phosphorylation-regulated kinase 1A isoform 1
NCBI Official Synonym Full Names
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
NCBI Official Symbol
DYRK1A
NCBI Official Synonym Symbols
MNB; DYRK; HP86; MNBH; MRD7; DYRK1
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 1A; hMNB; MNB/DYRK protein kinase; serine/threonine kinase MNB; mnb protein kinase homolog hp86; protein kinase minibrain homolog; dual specificity YAK1-related kinase; serine/threonine-specific p
UniProt Protein Name
Dual specificity tyrosine-phosphorylation-regulated kinase 1A
UniProt Gene Name
DYRK1A
UniProt Synonym Gene Names
DYRK; MNB; MNBH; MNBH; hMNB
UniProt Entry Name
DYR1A_HUMAN
Similar Products
Product Notes
The DYRK1A dyrk1a (Catalog #AAA24195) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DYRK1A (Dual Specificity Tyrosine-phosphorylation-regulated Kinase 1A, Protein Kinase Minibrain Homolog, MNBH, HP86, Dual Specificity YAK1-related Kinase, hMNB, DYRK, MNB, MNBH) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DYRK1A can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DYRK1A dyrk1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DYRK1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.