Mouse anti-Human EBNA2 Monoclonal Antibody | anti-EBNA2 antibody
Mouse monoclonal antibody Anti-Human EBNA2
Gene Names
SND1; p100; TDRD11
Reactivity
Human
Applications
Western Blot
Synonyms
EBNA2, Antibody; Mouse monoclonal antibody Anti-Human EBNA2; Homo sapiens EBNA-2 co-activator (100kD) mRNA,complete cds.; anti-EBNA2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1
Clone Number
287C1a
Form/Format
Mouse monoclonal anti-human EBNA2 Antibody in PBS (3.0 mM KCl, 1.5 mM KH2PO4, 140 mM NaCl, 8.0 mM Na2HPO4 (pH 7.4)) containing 1% bovine serum albumin (BSA) and 0.05% sodium azide (NaN3).
Sequence
GKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVT
Sequence Length
2733
Applicable Applications for anti-EBNA2 antibody
WB (Western Blot)
Immunogen
EBNA2 Recombinant protein
Preparation
This antibody was purified using protein G column chromatography from culture supernatant of hybridoma cultured in a medium containing bovine IgG-depleted (approximately 95%) fetal bovine serum.
Sterility
Filtered through a 0.22 um membrane.
Disposal
This antibody solution contains sodium azide (NaN3) as a preservative. There is a potential hazard that NaN3 reacts with copper or lead to produce an explosive compound. For safe disposal, the vial has to be washed thoroughly with water.
Safety warnings and precautions
Caution must be taken to avoid contact with skin or eyes. In such a case, rinse thoroughly at once with water. Do not ingest, inhale, or swallow. Seek medical attention immediately. Wear appropriate protective clothing such as laboratory overalls, safety glasses and gloves. It is strongly advised that this product should be handled by people who have been well trained in laboratory techniques and that it is handled with care pursuant to the principles of good laboratory practice. All chemicals are deemed potentially harmful.
The vial is prone to fall over. Use caution, especially when the lid is off.
The vial is prone to fall over. Use caution, especially when the lid is off.
Preparation and Storage
Store at 2-8 C for up to one year.
We recommend storing at –20 C for long-term storage.
Avoid repeat freezing and thawing cycles.
We recommend storing at –20 C for long-term storage.
Avoid repeat freezing and thawing cycles.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
101,997 Da
NCBI Official Full Name
Homo sapiens EBNA-2 co-activator (100kD) mRNA, complete cds
NCBI Official Synonym Full Names
staphylococcal nuclease and tudor domain containing 1
NCBI Official Symbol
SND1
NCBI Official Synonym Symbols
p100; TDRD11
NCBI Protein Information
staphylococcal nuclease domain-containing protein 1; 100 kDa coactivator; EBNA-2 co-activator (100kD); EBNA2 coactivator p100; SND1-BRAF fusion; Tudor-SN; p100 EBNA2 co-activator; p100 co-activator; staphylococcal nuclease domain containing 1; tudor domain-containing protein 11
UniProt Protein Name
Staphylococcal nuclease domain-containing protein 1
UniProt Gene Name
SND1
UniProt Entry Name
SND1_HUMAN
Similar Products
Product Notes
The EBNA2 snd1 (Catalog #AAA36524) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Mouse monoclonal antibody Anti-Human EBNA2 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EBNA2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the EBNA2 snd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GKEVCFTIEN KTPQGREYGM IYLGKDTNGE NIAESLVAEG LATRREGMRA NNPEQNRLSE CEEQAKAAKK GMWSEGNGSH TIRDLKYTIE NPRHFVDSHH QKPVNAIIEH VRDGSVVRAL LLPDYYLVT. It is sometimes possible for the material contained within the vial of "EBNA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
