Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human ENO3 Monoclonal Antibody | anti-ENO3 antibody

ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) (PE)

Gene Names
ENO3; MSE; GSD13
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENO3; Monoclonal Antibody; ENO3 (Enolase 3; 2-phospho-D-glycerate Hydro-lyase; beta-Enolase; Muscle-specific Enolase; MSE; Skeletal Muscle Enolase) (PE); anti-ENO3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5D1
Specificity
Recognizes human ENO3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ENO3 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa228-277 from human ENO3 (NP_001967) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of ENO3 over-expressed 293 cell line, cotransfected with ENO3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ENO3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged ENO3 is ~0.03ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged ENO3 is ~0.03ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ENO3 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ENO3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5ug/ml].)

WB (Western Blot)

(Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody. Lane 1: ENO3 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of ENO3 expression in transfected 293T cell line by ENO3 monoclonal antibody. Lane 1: ENO3 transfected lysate (46.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (31.24kD).)

WB (Western Blot) (Western Blot detection against Immunogen (31.24kD).)
Product Categories/Family for anti-ENO3 antibody
References
1. The time course of the adaptations of human muscle proteome to bed rest and the underlying mechanisms. Brocca L, Cannavino J, Coletto L, Biolo G, Sandri M, Bottinelli R, Pellegrino MA.J Physiol. 2012 Aug 6. 2. Functional analysis of beef tenderness. Guillemin N, Bonnet M, Jurie C, Picard B.J Proteomics. 2011 Aug 9. 3. Myomegalin is a novel A-kinase anchoring protein involved in the phosphorylation of cardiac myosin binding protein C. Uys GM, Ramburan A, Loos B, Kinnear CJ, Korkie LJ, Mouton J, Riedemann J, Moolman-Smook JC.BMC Cell Biol. 2011 May 10;12:18. 4. Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle. Chaze T, Meunier B, Chambon C, Jurie C, Picard B.Animal (2009) doi:10.1017 /S1751731 109004315. 5. Identification of alpha-Enolase as an Autoantigen in Lung Cancer: Its Overexpression Is Associated with Clinical Outcomes. Chang GC, Liu KJ, Hsieh CL, Hu TS, Charoenfuprasert S, Liu HK, Luh KT, Hsu LH, Wu CW, Ting CC, Chen CY, Chen KC, Yang TY, Chou TY, Wang WH, Whang-Peng J, Shih NY.Clin Cancer Res. 2006 Oct 1;12(19):5746-54.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
beta-enolase isoform 1
NCBI Official Synonym Full Names
enolase 3
NCBI Official Symbol
ENO3
NCBI Official Synonym Symbols
MSE; GSD13
NCBI Protein Information
beta-enolase
UniProt Protein Name
Beta-enolase
UniProt Gene Name
ENO3
UniProt Synonym Gene Names
MSE
UniProt Entry Name
ENOB_HUMAN

Similar Products

Product Notes

The ENO3 eno3 (Catalog #AAA25679) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENO3 (Enolase 3, 2-phospho-D-glycerate Hydro-lyase, beta-Enolase, Muscle-specific Enolase, MSE, Skeletal Muscle Enolase) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENO3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENO3 eno3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENO3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.