WB (Western Blot)
(Western blot analysis of lysates from Mouse brain, using Eph receptor B3 (EPHB3) Rabbit mAb (AAA282698) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Rabbit anti-Human EpHreceptor B3 (EPHB3) Monoclonal Antibody | anti-EPHB3 antibody
EpHreceptor B3 (EPHB3) Rabbit mAb
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
EpHreceptor B3 (EPHB3), Antibody; EpHreceptor B3 (EPHB3) Rabbit mAb; EK2; ETK2; HEK2; TYRO6; EpHreceptor B3 (EPHB3); anti-EPHB3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
SELAWTSHPESGWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSDVASASSPFWM
Applicable Applications for anti-EPHB3 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EpHreceptor B3 (EPHB3)(EPHB3)(P54753).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of lysates from Mouse brain, using Eph receptor B3 (EPHB3) Rabbit mAb (AAA282698) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse brain, using Eph receptor B3 (EPHB3) Rabbit mAb (AAA282698) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
WB (Western Blot)
(Western blot analysis of various lysates using Eph receptor B3 (EPHB3) Rabbit mAb (AAA282698) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
WB (Western Blot)
(Western blot analysis of various lysates using Eph receptor B3 (EPHB3) Rabbit mAb (AAA282698) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-EPHB3 antibody
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The EpHfamily of receptors are divided into two groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. This gene encodes a receptor for ephrin-B family members.
Product Categories/Family for anti-EPHB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
Calculated MW: 110kDa
Observed MW: 110kDa
Observed MW: 110kDa
UniProt Protein Name
Ephrin type-B receptor 3
UniProt Gene Name
EPHB3
UniProt Synonym Gene Names
ETK2; HEK2; TYRO6; EPH-like kinase 2; EK2; hEK2
UniProt Entry Name
EPHB3_HUMAN
Similar Products
Product Notes
The EPHB3 ephb3 (Catalog #AAA282698) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EpHreceptor B3 (EPHB3) Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EpHreceptor B3 (EPHB3) can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the EPHB3 ephb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SELAWTSHPE SGWEEVSGYD EAMNPIRTYQ VCNVRESSQN NWLRTGFIWR RDVQRVYVEL KFTVRDCNSI PNIPGSCKET FNLFYYEADS DVASASSPFW M. It is sometimes possible for the material contained within the vial of "EpHreceptor B3 (EPHB3), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.