Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283071_ChIP8.jpg ChIP (Chromatin immunoprecipitation) (Chromatin immunoprecipitation was performed with 10 ug of cross-linked chromatin from K-562, using 5 ug of [KD Validated] ETV1 Rabbit mAb (AAA283071) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.)

Rabbit anti-Human ETV1 Monoclonal Antibody | anti-ETV1 antibody

[KD Validated] ETV1 Rabbit mAb

Reactivity
Human
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
ETV1, Antibody; [KD Validated] ETV1 Rabbit mAb; ER81; anti-ETV1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEIS
Applicable Applications for anti-ETV1 antibody
ChIP (Chromatin immunoprecipitation), ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ETV1 (NP_004947.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin immunoprecipitation)

(Chromatin immunoprecipitation was performed with 10 ug of cross-linked chromatin from K-562, using 5 ug of [KD Validated] ETV1 Rabbit mAb (AAA283071) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.)

product-image-AAA283071_ChIP8.jpg ChIP (Chromatin immunoprecipitation) (Chromatin immunoprecipitation was performed with 10 ug of cross-linked chromatin from K-562, using 5 ug of [KD Validated] ETV1 Rabbit mAb (AAA283071) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.)

IP (Immunoprecipitation)

(Immunoprecipitation of ETV1 from 600 ug extracts of Mouse brain was performed using 1 ug of [KD Validated] ETV1 Rabbit mAb (AAA283071). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using ETV1 Rabbit mAb (AAA283071) at a dilution of 1:5000.)

product-image-AAA283071_IP10.jpg IP (Immunoprecipitation) (Immunoprecipitation of ETV1 from 600 ug extracts of Mouse brain was performed using 1 ug of [KD Validated] ETV1 Rabbit mAb (AAA283071). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using ETV1 Rabbit mAb (AAA283071) at a dilution of 1:5000.)

WB (Western Blot)

(Western blot analysis of various lysates using [KD Validated] ETV1 Rabbit mAb (AAA283071) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA283071_WB11.jpg WB (Western Blot) (Western blot analysis of various lysates using [KD Validated] ETV1 Rabbit mAb (AAA283071) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

WB (Western Blot)

(Western blot analysis of lysates from SH-SY5Y cells using [KD Validated] ETV1 Rabbit mAb (AAA283071) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

product-image-AAA283071_WB13.jpg WB (Western Blot) (Western blot analysis of lysates from SH-SY5Y cells using [KD Validated] ETV1 Rabbit mAb (AAA283071) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and ETV1 knockdown (KD) HeLa cells using [KD Validated] ETV1 Rabbit mAb (AAA283071) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

product-image-AAA283071_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and ETV1 knockdown (KD) HeLa cells using [KD Validated] ETV1 Rabbit mAb (AAA283071) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
Related Product Information for anti-ETV1 antibody
This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 55kDa
Observed MW: 55kDa
UniProt Protein Name
ETS translocation variant 1
UniProt Gene Name
ETV1
UniProt Synonym Gene Names
ER81
UniProt Entry Name
ETV1_HUMAN

Similar Products

Product Notes

The ETV1 etv1 (Catalog #AAA283071) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KD Validated] ETV1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ETV1 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the ETV1 etv1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDGFYDQQVP YMVTNSQRGR NCNEKPTNVR KRKFINRDLA HDSEELFQDL SQLQETWLAE AQVPDNDEQF VPDYQAESLA FHGLPLKIKK EPHSPCSEIS. It is sometimes possible for the material contained within the vial of "ETV1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.