Mouse FGL2 Monoclonal Antibody | anti-FGL2 antibody

FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49) APC

Cat. Num. AAA24505

• Gene Names: FGL2; T49; pT49
• Reactivity: Human, Mouse, Rat
• Applications: Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FGL2, Antibody; FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49) APC; anti-FGL2 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6D9
• Specificity: Recognizes human FGL2. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-FGL2 antibody: FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: IHC-P: 0.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa24-123 from human FGL2 (NP_006673) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

WB (Western Blot)

(FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in PC-12.)

Application Data

(Detection limit for recombinant GST tagged FGL2 is ~0.1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of FGL2 transfected lysate using FGL2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FGL2 rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5ug/ml].)

WB (Western Blot)

(Western Blot analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody Lane 1: FGL2 transfected lysate (50kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in Raw 264.7.)

Product Categories/Family for anti-FGL2 antibody

Antibodies; Fibrinogen

References

1. FGL2/Fibroleukin Mediates Hepatic Reperfusion Injury by Induction of Sinusoidal Endothelial Cell and Hepatocyte Apoptosis in Mice. Selzner N, Liu H, Boehnert MU, Adeyi OA, Shalev I, Bartczak AM, Xue-Zhong M, Manuel J, Rotstein OD, McGilvray ID, Grant DR, Phillips MJ, Levy GA, Selzner M.J Hepatol. 2011 Jul 11. 2. The FGL2/fibroleukin prothrombinase is involved in alveolar macrophage activation in COPD through the MAPK pathway. Liu Y, Xu S, Xiao F, Xiong Y, Wang X, Gao S, Yan W, Ning Q.Biochem Biophys Res Commun. 2010 May 7. 3. Targeted Deletion of fgl2 Leads to Impaired Regulatory T Cell Activity and Development of Autoimmune Glomerulonephritis1. Shalev I, Liu H, Koscik C, Bartczak A, Javadi M, Wong KM, Maknojia A, He W, Liu MF, Diao J, Winter E, Manuel J, McCarthy D, Cattral M, Gommerman J, Clark DA, Phillips MJ, Gorczynski RR, Zhang L, Downey G, Grant D, Cybulsky MI, Levy G.J Immunol. 2008 Jan 1;180(1):249-60. 4. Expression of Prothrombin and Protease Activated Receptors in Human Myometrium During Pregnancy and Labor. O'brien M, Morrison JJ, Smith TJ.Biol Reprod. 2008 Jan;78(1):20-6. Epub 2007 Sep 26.

NCBI and Uniprot Product Information

• NCBI GI #: 5730075
• NCBI GeneID: 10875
• NCBI Accession #: NP_006673
• NCBI GenBank Nucleotide #: NM_006682
• UniProt Accession #: Q14314
• Molecular Weight: 48
• NCBI Official Full Name: fibroleukin
• NCBI Official Synonym Full Names: fibrinogen like 2
• NCBI Official Symbol: FGL2
• NCBI Official Synonym Symbols: T49; pT49
• NCBI Protein Information: fibroleukin
• UniProt Protein Name: Fibroleukin
• UniProt Gene Name: FGL2
• UniProt Entry Name: FGL2_HUMAN