Mouse Fibroblast Growth Factor 8 Monoclonal Antibody | anti-FGF8 antibody

Fibroblast Growth Factor 8 (FGF8, FGF-8, Androgen-induced Growth Factor, AIGF, Heparin-binding Growth Factor 8, HBGF-8) (Biotin)

Cat. Num. AAA24802

• Gene Names: FGF8; HH6; AIGF; KAL6; FGF-8; HBGF-8
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Fibroblast Growth Factor 8; Monoclonal Antibody; Fibroblast Growth Factor 8 (FGF8; FGF-8; Androgen-induced Growth Factor; AIGF; Heparin-binding Growth Factor 8; HBGF-8) (Biotin); anti-FGF8 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A10
• Specificity: Recognizes human FGF8. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-FGF8 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa65-133 from human FGF8 (NP_149354) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged FGF8 is ~0.3ng/ml as a capture antibody.)

WB (Western Blot)

(FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in NIH/3T3.)

WB (Western Blot)

(FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in Jurkat.)

WB (Western Blot)

(FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in Raw 264.7.)

WB (Western Blot)

(FGF8 monoclonal antibody, Western Blot analysis of FGF8 expression in HepG2.)

WB (Western Blot)

(FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in PC-12.)

Related Product Information for anti-FGF8 antibody

Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth Factor (AIGF), a heparin binding growth factor, which stimulates the proliferation and activation of cells that express the FGF receptors. Recombinant human FGF-8 is a 22.4kD protein containing 193aa residues.

Product Categories/Family for anti-FGF8 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 15147348
• NCBI GeneID: 2253
• NCBI Accession #: NP_149354
• NCBI GenBank Nucleotide #: NM_033164
• UniProt Accession #: P55075
• Molecular Weight: 24kDa
• NCBI Official Full Name: fibroblast growth factor 8 isoform E
• NCBI Official Synonym Full Names: fibroblast growth factor 8
• NCBI Official Symbol: FGF8
• NCBI Official Synonym Symbols: HH6; AIGF; KAL6; FGF-8; HBGF-8
• NCBI Protein Information: fibroblast growth factor 8
• UniProt Protein Name: Fibroblast growth factor 8
• UniProt Gene Name: FGF8
• UniProt Synonym Gene Names: AIGF; FGF-8; AIGF; HBGF-8
• UniProt Entry Name: FGF8_HUMAN