Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HeLa.)

Mouse anti-Human FLJ23356 Monoclonal Antibody

FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597)

Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FLJ23356; Monoclonal Antibody; FLJ23356 (SGK196; Probable Inactive Protein Kinase-like Protein SgK196; Sugen Kinase 196; MGC126597); Anti -FLJ23356 (SGK196; anti-FLJ23356 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6F10
Specificity
Recognizes human FLJ23356.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML
Applicable Applications for anti-FLJ23356 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa251-351 from human FLJ23356 (NP_115613) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HeLa.)

WB (Western Blot) (FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HeLa.)

WB (Western Blot)

(FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HepG2.)

WB (Western Blot) (FLJ23356 monoclonal antibody. Western Blot analysis of FLJ23356 expression in HepG2.)

Application Data

(Detection limit for recombinant GST tagged FLJ23356 is ~0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged FLJ23356 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FLJ23356 on HeLa cell. [antibody concentration 10ug/ml].)

IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to FLJ23356 on HeLa cell. [antibody concentration 10ug/ml].)

WB (Western Blot)

(Western Blot analysis of FLJ23356 expression in transfected 293T cell line by FLJ23356 monoclonal antibody.Lane 1: FLJ23356 transfected lysate (38.5kD).Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of FLJ23356 expression in transfected 293T cell line by FLJ23356 monoclonal antibody.Lane 1: FLJ23356 transfected lysate (38.5kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western blot analysis of FLJ23356 over-expressed 293 cell line, cotransfected with FLJ23356 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FLJ23356 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of FLJ23356 over-expressed 293 cell line, cotransfected with FLJ23356 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FLJ23356 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-FLJ23356 antibody
SGK196 belongs to the protein kinase superfamily. Ser/Thr protein kinase family. STKL subfamily
Product Categories/Family for anti-FLJ23356 antibody

Similar Products

Product Notes

The FLJ23356 (Catalog #AAA24066) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FLJ23356 (SGK196, Probable Inactive Protein Kinase-like Protein SgK196, Sugen Kinase 196, MGC126597) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FLJ23356 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the FLJ23356 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GDFVAPEQLW PYGEDVPFHD DLMPSYDEKI DIWKIPDISS FLLGHIEGSD MVRFHLFDIH KACKSQTPSE RPTAQDVLET YQKVLDTLRD AMMSQAREML. It is sometimes possible for the material contained within the vial of "FLJ23356, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.