Rabbit anti-Human FMO3 Monoclonal Antibody | anti-FMO3 antibody

FMO3 Rabbit mAb

Cat. Num. AAA282694

• Reactivity: Human
• Applications: ELISA, Immunocytochemistry, Immunofluorescence, Western Blot
• Purity: Affinity purification
• Synonyms: FMO3, Antibody; FMO3 Rabbit mAb; TMAU; FMOII; dJ127D3.1; FMO3; anti-FMO3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
• Sequence: KPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLP

• Applicable Applications for anti-FMO3 antibody: ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
• Cross Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human FMO3 (P31513).
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Rat liver tissue using FMO3 Rabbit mAb (AAA282694, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Human liver tissue using FMO3 Rabbit mAb (AAA282694, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse liver tissue using FMO3 Rabbit mAb (AAA282694, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

WB (Western Blot)

(Western blot analysis of various lysates using FMO3 Rabbit mAb (AAA282694) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

WB (Western Blot)

(Western blot analysis of various lysates using FMO3 Rabbit mAb (AAA282694) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Related Product Information for anti-FMO3 antibody

Flavin-containing monooxygenases (FMO) are an important class of drug-metabolizing enzymes that catalyze the NADPH-dependent oxygenation of various nitrogen-, sulfur-, and phosphorous-containing xenobiotics such as therapeutic drugs, dietary compounds, pesticides, and other foreign compounds. The human FMO gene family is composed of 5 genes and multiple pseudogenes. FMO members have distinct developmental- and tissue-specific expression patterns. The expression of this FMO3 gene, the major FMO expressed in adult liver, can vary up to 20-fold between individuals. This inter-individual variation in FMO3 expression levels is likely to have significant effects on the rate at which xenobiotics are metabolised and, therefore, is of considerable interest to the pharmaceutical industry. This transmembrane protein localizes to the endoplasmic reticulum of many tissues. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Mutations in this gene cause the disorder trimethylaminuria (TMAu) which is characterized by the accumulation and excretion of unmetabolized trimethylamine and a distinctive body odor. In healthy individuals, trimethylamine is primarily converted to the non odorous trimethylamine N-oxide.

Product Categories/Family for anti-FMO3 antibody

Signal Transduction; Endocrine Metabolism; Drug metabolism; Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 6166183
• NCBI GeneID: 2328
• UniProt Accession #: P31513; Q14854; Q8N5N5; B2R816
• Molecular Weight: Calculated MW: 60kDa; Observed MW: 58kDa
• UniProt Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 3
• UniProt Gene Name: FMO3
• UniProt Synonym Gene Names: FMO 3
• UniProt Entry Name: FMO3_HUMAN