Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26645_IHC6.jpg IHC (Immunohistchemistry) (Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml])

Mouse FOXA2 Monoclonal Antibody | anti-FOXA2 antibody

FOXA2 (Forkhead Box A2, HNF3B, MGC19807, TCF3B) (PE)

Gene Names
FOXA2; HNF3B; TCF3B
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
FOXA2, Antibody; FOXA2 (Forkhead Box A2, HNF3B, MGC19807, TCF3B) (PE); Forkhead Box A2; HNF3B; MGC19807; TCF3B; anti-FOXA2 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6C12
Specificity
Recognizes FOXA2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FOXA2 antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOXA2 (NP_068556, 363aa-457aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IHC (Immunohistchemistry)

(Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml])

product-image-AAA26645_IHC6.jpg IHC (Immunohistchemistry) (Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml])

product-image-AAA26645_IHC5.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to FOXA2 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.5 ug/ml])

Application Data

(Detection limit for recombinant GST tagged FOXA2 is approximately 0.3ng/ml as a capture antibody.)

product-image-AAA26645_APP4.jpg Application Data (Detection limit for recombinant GST tagged FOXA2 is approximately 0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26645_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26645_IF2.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to FOXA2 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(FOXA2 monoclonal antibody (M12), clone 6C12 Western Blot analysis of FOXA2 expression in K-562 (Cat # L009V1).)

product-image-AAA26645_WB.jpg WB (Western Blot) (FOXA2 monoclonal antibody (M12), clone 6C12 Western Blot analysis of FOXA2 expression in K-562 (Cat # L009V1).)
Related Product Information for anti-FOXA2 antibody
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]
Product Categories/Family for anti-FOXA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 51 kDa

Observed: 54 kDa
NCBI Official Full Name
hepatocyte nuclear factor 3-beta isoform 1
NCBI Official Synonym Full Names
forkhead box A2
NCBI Official Symbol
FOXA2
NCBI Official Synonym Symbols
HNF3B; TCF3B
NCBI Protein Information
hepatocyte nuclear factor 3-beta; HNF-3B; TCF-3B; HNF-3-beta; forkhead box protein A2; transcription factor 3B; hepatic nuclear factor-3-beta; hepatocyte nuclear factor 3, beta
UniProt Protein Name
Hepatocyte nuclear factor 3-beta
UniProt Gene Name
FOXA2
UniProt Synonym Gene Names
HNF3B; TCF3B; HNF-3-beta; HNF-3B; TCF-3B
UniProt Entry Name
FOXA2_HUMAN

Similar Products

Product Notes

The FOXA2 foxa2 (Catalog #AAA26645) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOXA2 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXA2 foxa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.