Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283098_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of Jurkat cells using 3 ug FOXP3 antibody (AAA283098). Western blot was performed from the immunoprecipitate using FOXP3 antibody (AAA283098) at a dilution of 1:1000.)

Rabbit anti-Human FOXP3 Monoclonal Antibody | anti-FOXP3 antibody

FOXP3 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
FOXP3, Antibody; FOXP3 Rabbit mAb; JM2; AIID; IPEX; PIDX; XPID; DIETER; FOXP3; anti-FOXP3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
GSQGPVVPAWSGPREAPDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTLNEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQRPSRCSNPTPGP
Applicable Applications for anti-FOXP3 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 286-431 of human FOXP3 (Q9BZS1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of Jurkat cells using 3 ug FOXP3 antibody (AAA283098). Western blot was performed from the immunoprecipitate using FOXP3 antibody (AAA283098) at a dilution of 1:1000.)

product-image-AAA283098_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of Jurkat cells using 3 ug FOXP3 antibody (AAA283098). Western blot was performed from the immunoprecipitate using FOXP3 antibody (AAA283098) at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of lysates from Jurkat cells, using FOXP3 Rabbit mAb (AAA283098) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA283098_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from Jurkat cells, using FOXP3 Rabbit mAb (AAA283098) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-FOXP3 antibody
The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene are the cause of immunodeficiency polyendocrinopathy, enteropathy, X-linked syndrome (IPEX), also known as X-linked autoimmunity-immunodeficiency syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 47kDa
Observed MW: 45kDa
UniProt Protein Name
Forkhead box protein P3
UniProt Gene Name
FOXP3
UniProt Synonym Gene Names
IPEX
UniProt Entry Name
FOXP3_HUMAN

Similar Products

Product Notes

The FOXP3 foxp3 (Catalog #AAA283098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXP3 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXP3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the FOXP3 foxp3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GSQGPVVPAW SGPREAPDSL FAVRRHLWGS HGNSTFPEFL HNMDYFKFHN MRPPFTYATL IRWAILEAPE KQRTLNEIYH WFTRMFAFFR NHPATWKNAI RHNLSLHKCF VRVESEKGAV WTVDELEFRK KRSQRPSRCS NPTPGP. It is sometimes possible for the material contained within the vial of "FOXP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.