Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24038_WB6.jpg WB (Western Blot) (FUSIP1 monoclonal antibody Western Blot analysis of FUSIP1 expression in Hela NE.)

Mouse anti-Human FUSIP1 Monoclonal Antibody | anti-SRSF10 antibody

FUSIP1 (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/Arginine-rich Splicing Factor 10, 40kD SR-repressor Protein, FUS-interacting Serine-arginine-rich Protein 1, Splicing Factor SRp38, Splicing Factor, Arginine/Serine-rich 13A, TLS-associated Protein wit

Average rating 0.0
No ratings yet
Gene Names
SRSF10; NSSR; TASR; SRp38; TASR1; TASR2; FUSIP1; FUSIP2; SFRS13; SRrp40; SFRS13A
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FUSIP1, Antibody; FUSIP1 (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/Arginine-rich Splicing Factor 10, 40kD SR-repressor Protein, FUS-interacting Serine-arginine-rich Protein 1, Splicing Factor SRp38, Splicing Factor, Arginine/Serine-rich 13A, TLS-associated Protein wit; Anti -FUSIP1 (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/Arginine-rich Splicing Factor 10, 40kD SR-repressor Protein, FUS-interacting Serine-arginine-rich Protein 1, Splicing Factor SRp38, Splicing Factor, Arginine/Serine-rich 13A, TLS-associated Protein wit; anti-SRSF10 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A6
Specificity
Recognizes human FUSIP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKE
Applicable Applications for anti-SRSF10 antibody
ELISA, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa1-100 from human FUSIP1 (AAH05039) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(FUSIP1 monoclonal antibody Western Blot analysis of FUSIP1 expression in Hela NE.)

product-image-AAA24038_WB6.jpg WB (Western Blot) (FUSIP1 monoclonal antibody Western Blot analysis of FUSIP1 expression in Hela NE.)

Application Data

(Detection limit for recombinant GST tagged FUSIP1 is ~0.1ng/ml as a capture antibody.)

product-image-AAA24038_APP5.jpg Application Data (Detection limit for recombinant GST tagged FUSIP1 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to FUSIP1 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA24038_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to FUSIP1 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to FUSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

product-image-AAA24038_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to FUSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of FUSIP1 expression in transfected 293T cell line by FUSIP1 monoclonal antibody Lane 1: FUSIP1 transfected lysate (22.2kD).Lane 2: Non-transfected lysate.)

product-image-AAA24038_WB2.jpg WB (Western Blot) (Western Blot analysis of FUSIP1 expression in transfected 293T cell line by FUSIP1 monoclonal antibody Lane 1: FUSIP1 transfected lysate (22.2kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

product-image-AAA24038_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Related Product Information for anti-SRSF10 antibody
Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator.
Product Categories/Family for anti-SRSF10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
31,301 Da
NCBI Official Full Name
FUSIP1 protein
NCBI Official Synonym Full Names
serine/arginine-rich splicing factor 10
NCBI Official Symbol
SRSF10
NCBI Official Synonym Symbols
NSSR; TASR; SRp38; TASR1; TASR2; FUSIP1; FUSIP2; SFRS13; SRrp40; SFRS13A
NCBI Protein Information
serine/arginine-rich splicing factor 10; SR splicing factor 10; splicing factor SRp38; TLS-associated SR protein; neural-salient SR protein; 40 kDa SR-repressor protein; TLS-associated protein TASR; TLS-associated protein with SR repeats; TLS-associated serine-arginine protein 1; TLS-associated serine-arginine protein 2; splicing factor, arginine/serine-rich 13; splicing factor, arginine/serine-rich 13A; serine-arginine repressor protein (40 kDa); TLS-associated protein with Ser-Arg repeats; FUS-interacting serine-arginine-rich protein 1; FUS interacting protein (serine-arginine rich) 1; FUS-interacting protein (serine-arginine rich) 2
UniProt Protein Name
Serine/arginine-rich splicing factor 10
UniProt Gene Name
SRSF10
UniProt Synonym Gene Names
FUSIP1; FUSIP2; SFRS13A; TASR; SRrp40; TASR; TLS-associated protein with SR repeats
UniProt Entry Name
SRS10_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The SRSF10 srsf10 (Catalog #AAA24038) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FUSIP1 (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/Arginine-rich Splicing Factor 10, 40kD SR-repressor Protein, FUS-interacting Serine-arginine-rich Protein 1, Splicing Factor SRp38, Splicing Factor, Arginine/Serine-rich 13A, TLS-associated Protein wit reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FUSIP1 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the SRSF10 srsf10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSRYLRPPNT SLFVRNVADD TRSEDLRREF GRYGPIVDVY VPLDFYTRRP RGFAYVQFED VRDAEDALHN LDRKWICGRQ IEIQFAQGDR KTPNQMKAKE. It is sometimes possible for the material contained within the vial of "FUSIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.