Mouse anti-Human GDF9 (Growth Differentiation Factor 9) Monoclonal Antibody | anti-GDF9 antibody
GDF9 (Growth Differentiation Factor 9) Mouse Monoclonal Antibody [Clone GDF9/4261]
Reactivity
Human
Applications
Immunohistochemistry, Western Blot, ELISA
Synonyms
GDF9 (Growth Differentiation Factor 9), Antibody; GDF9 (Growth Differentiation Factor 9) Mouse Monoclonal Antibody [Clone GDF9/4261]; Growth/differentiation factor 9, GDF-9, GDF9; anti-GDF9 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
Mouse/IgG1
Clone Number
GDF9/4261
Form/Format
200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0. 05% BSA & 0. 05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Concentration
Purified Ab with BSA and Azide at 200ug/ml
OR
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml (varies by lot)
OR
Purified Ab WITHOUT BSA and Azide at 1.0mg/ml (varies by lot)
Applicable Applications for anti-GDF9 antibody
IHC (Immunohistochemistry), WB (Western Blot), ELISA
Immunogen
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.
Cellular Localization
Cytoplasmic (secreted)
Positive Control
Human ovary.
Hu-chromosome Location
5q31.1
Unigene
25022
Preparation and Storage
Antibody with azide: store at 2 to 8 degree C
Antibody without azide: store at -20 to -80 degree C
Antibody is stable for 24 months. Non-hazardous. No MSDS required.
Antibody without azide: store at -20 to -80 degree C
Antibody is stable for 24 months. Non-hazardous. No MSDS required.
Related Product Information for anti-GDF9 antibody
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,444 Da
NCBI Official Full Name
growth/differentiation factor 9 preproprotein
NCBI Official Synonym Full Names
growth differentiation factor 9
NCBI Official Symbol
GDF9
NCBI Protein Information
growth/differentiation factor 9; GDF-9
UniProt Protein Name
Growth/differentiation factor 9
UniProt Gene Name
GDF9
UniProt Synonym Gene Names
GDF-9
UniProt Entry Name
GDF9_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The GDF9 gdf9 (Catalog #AAA215677) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GDF9 (Growth Differentiation Factor 9) Mouse Monoclonal Antibody [Clone GDF9/4261] reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GDF9 (Growth Differentiation Factor 9) can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the GDF9 gdf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GDF9 (Growth Differentiation Factor 9), Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
