Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283099_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit anti-Human GLP-1 Monoclonal Antibody | anti-GCG antibody

GLP-1 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunocytochemistry, Immunofluorescence, Immunohistochemistry
Purity
Affinity purification
Synonyms
GLP-1, Antibody; GLP-1 Rabbit mAb; GLP1; GLP2; GRPP; GLP-1; anti-GCG antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
RAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGS
Applicable Applications for anti-GCG antibody
ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry)
Cross Reactivity
Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 70-150 of human GLP-1 (P01275).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of mouse pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA283099_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of mouse pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of rat pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA283099_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of rat pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

product-image-AAA283099_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)

product-image-AAA283099_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat pancreas using GLP-1 Rabbit mAb (AAA283099) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.)
Related Product Information for anti-GCG antibody
The protein encoded by this gene is actually a preproprotein that is cleaved into four distinct mature peptides. One of these, glucagon, is a pancreatic hormone that counteracts the glucose-lowering action of insulin by stimulating glycogenolysis and gluconeogenesis. Glucagon is a ligand for a specific G-protein linked receptor whose signalling pathway controls cell proliferation. Two of the other peptides are secreted from gut endocrine cells and promote nutrient absorption through distinct mechanisms. Finally, the fourth peptide is similar to glicentin, an active enteroglucagon.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 21kDa
UniProt Protein Name
Glucagon
UniProt Gene Name
GCG
UniProt Synonym Gene Names
GRPP; OXM; OXY; GLP-1; GLP-1(7-37); GLP-1(7-36); GLP-2
UniProt Entry Name
GLUC_HUMAN

Similar Products

Product Notes

The GCG gcg (Catalog #AAA283099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GLP-1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLP-1 can be used in a range of immunoassay formats including, but not limited to, ELISA, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the GCG gcg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RAQDFVQWLM NTKRNRNNIA KRHDEFERHA EGTFTSDVSS YLEGQAAKEF IAWLVKGRGR RDFPEEVAIV EELGRRHADG S. It is sometimes possible for the material contained within the vial of "GLP-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.