Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA330080_IHC13.jpg IHC (Immunohiostchemistry) (AAA330080 at 1/100 staining mouse spleen tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Mouse antibody was used as the secondary antibody.)

Mouse Glucagon Monoclonal Antibody | anti-GCG antibody

Glucagon Mouse Monoclonal Antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Affinity-chromatography.
Synonyms
Glucagon, Antibody; Glucagon Mouse Monoclonal Antibody; GCG;glicentin-related polypeptide;GLP-1;GLP-1(7-36);GLP-1(7-37);GLP-2;GLP1;GLP1, included;GLP2;GLP2, included;GLUC_HUMAN;Glucagon;Glucagon like peptide 1;glucagon-like peptide 1;Glucagon-like peptide 1, included;Glucagon-like peptide 2;Glucagon-like peptide 2, included;GRPP;OXM;OXY;preproglucagon; anti-GCG antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
GLP1 Antibody detects endogenous levels of total GLP1.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Applicable Applications for anti-GCG antibody
ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthesized peptide derived from human GLP1, corresponding to a region within the internal amino acids.
Conjugation
Unconjugated
Expression
Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP-1 and GLP-2 are also secreted in selected neurons in the brain.
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.

IHC (Immunohiostchemistry)

(AAA330080 at 1/100 staining mouse spleen tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Mouse antibody was used as the secondary antibody.)

product-image-AAA330080_IHC13.jpg IHC (Immunohiostchemistry) (AAA330080 at 1/100 staining mouse spleen tissue by IHC-P. The sample was formaldehyde fixed and a heat mediated antigen retrieval step in citrate buffer was performed. The sample was then blocked and incubated with the primary antibody at 4 degree C overnight. An HRP conjugated anti-Mouse antibody was used as the secondary antibody.)

WB (Western Blot)

(Western blot analysis of extracts from various samples, using Glucagon Mouse Monoclonal Antibody. Lane 1: rat spleen tissue treated with blocking-peptides, Lane 2: rat spleen tissue, Lane 3: mouse spleen tissue.)

product-image-AAA330080_WB15.jpg WB (Western Blot) (Western blot analysis of extracts from various samples, using Glucagon Mouse Monoclonal Antibody. Lane 1: rat spleen tissue treated with blocking-peptides, Lane 2: rat spleen tissue, Lane 3: mouse spleen tissue.)
Related Product Information for anti-GCG antibody
GCG Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia. Plays an important role in initiating and maintaining hyperglycemic conditions in diabetes. Belongs to the glucagon family. Glucagon release is stimulated by hypoglycemia and inhibited by hyperglycemia, insulin, and somatostatin. GLP-1 and GLP-2 are induced in response to nutrient ingestion.
Product Categories/Family for anti-GCG antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
25kD; 21kD(Calculated)

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The GCG (Catalog #AAA330080) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Glucagon Mouse Monoclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Glucagon can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the GCG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKSIYFVAGL FVMLVQGSWQ RSLQDTEEKS RSFSASQADP LSDPDQMNED KRHSQGTFTS DYSKYLDSRR AQDFVQWLMN TKRNRNNIAK RHDEFERHAE GTFTSDVSSY LEGQAAKEFI AWLVKGRGRR DFPEEVAIVE ELGRRHADGS FSDEMNTILD NLAARDFINW LIQTKITDRK. It is sometimes possible for the material contained within the vial of "Glucagon, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.