Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282749_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of U-251MG cells using 3 ug Glucocorticoid Receptor antibody (AAA282749). Western blot was performed from the immunoprecipitate using Glucocorticoid Receptor antibody (AAA282749) at a dilution of 1:1000.)

Rabbit anti-Human Glucocorticoid Receptor Monoclonal Antibody | anti-NR3C1 antibody

Glucocorticoid Receptor Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
Glucocorticoid Receptor, Antibody; Glucocorticoid Receptor Rabbit mAb; GR; GCR; GRL; GCCR; GCRST; Glucocorticoid Receptor; anti-NR3C1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGN
Applicable Applications for anti-NR3C1 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2-180 of human GR (P04150).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of U-251MG cells using 3 ug Glucocorticoid Receptor antibody (AAA282749). Western blot was performed from the immunoprecipitate using Glucocorticoid Receptor antibody (AAA282749) at a dilution of 1:1000.)

product-image-AAA282749_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of U-251MG cells using 3 ug Glucocorticoid Receptor antibody (AAA282749). Western blot was performed from the immunoprecipitate using Glucocorticoid Receptor antibody (AAA282749) at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of various lysates using Glucocorticoid Receptor Rabbit mAb (AAA282749) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

product-image-AAA282749_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using Glucocorticoid Receptor Rabbit mAb (AAA282749) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-NR3C1 antibody
This gene encodes glucocorticoid receptor, which can function both as a transcription factor that binds to glucocorticoid response elements in the promoters of glucocorticoid responsive genes to activate their transcription, and as a regulator of other transcription factors. This receptor is typically found in the cytoplasm, but upon ligand binding, is transported into the nucleus. It is involved in inflammatory responses, cellular proliferation, and differentiation in target tissues. Mutations in this gene are associated with generalized glucocorticoid resistance. Alternative splicing of this gene results in transcript variants encoding either the same or different isoforms. Additional isoforms resulting from the use of alternate in-frame translation initiation sites have also been described, and shown to be functional, displaying diverse cytoplasm-to-nucleus trafficking patterns and distinct transcriptional activities (PMID:15866175).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 86kDa
Observed MW: 95kDa
UniProt Protein Name
Glucocorticoid receptor
UniProt Gene Name
NR3C1
UniProt Synonym Gene Names
GRL; GR
UniProt Entry Name
GCR_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The NR3C1 nr3c1 (Catalog #AAA282749) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Glucocorticoid Receptor Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Glucocorticoid Receptor can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the NR3C1 nr3c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DSKESLTPGR EENPSSVLAQ ERGDVMDFYK TLRGGATVKV SASSPSLAVA SQSDSKQRRL LVDFPKGSVS NAQQPDLSKA VSLSMGLYMG ETETKVMGND LGFPQQGQIS LSSGETDLKL LEESIANLNR STSVPENPKS SASTAVSAAP TEKEFPKTHS DVSSEQQHLK GQTGTNGGN. It is sometimes possible for the material contained within the vial of "Glucocorticoid Receptor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.