Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24226_WB6.jpg WB (Western Blot) (GNRHR2 monoclonal antibody, Western Blot analysis of GNRHR2 expression in HeLa.)

Mouse anti-Human, Mouse GNRHR2 Monoclonal Antibody | anti-GNRHR2 antibody

GNRHR2 (Putative Gonadotropin-releasing Hormone II Receptor, GnRH II Receptor, GnRH-II-R, Type II GnRH Receptor) (AP)

Gene Names
FZD2; Fz2; fz-2; fzE2; hFz2; OMOD2
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GNRHR2, Antibody; GNRHR2 (Putative Gonadotropin-releasing Hormone II Receptor, GnRH II Receptor, GnRH-II-R, Type II GnRH Receptor) (AP); anti-GNRHR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A5
Specificity
Recognizes human GNRHR2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GNRHR2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa237-293 from human GNRHR2 (NP_476504.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(GNRHR2 monoclonal antibody, Western Blot analysis of GNRHR2 expression in HeLa.)

product-image-AAA24226_WB6.jpg WB (Western Blot) (GNRHR2 monoclonal antibody, Western Blot analysis of GNRHR2 expression in HeLa.)

Application Data

(Detection limit for recombinant GST tagged GNRHR2 is ~0.03ng/ml as a capture antibody.)

product-image-AAA24226_APP5.jpg Application Data (Detection limit for recombinant GST tagged GNRHR2 is ~0.03ng/ml as a capture antibody.)

WB (Western Blot)

(GNRHR2 monoclonal antibody. Western Blot analysis of GNRHR2 expression in NIH/3T3.)

product-image-AAA24226_WB4.jpg WB (Western Blot) (GNRHR2 monoclonal antibody. Western Blot analysis of GNRHR2 expression in NIH/3T3.)

WB (Western Blot)

(GNRHR2 monoclonal antibody. Western Blot analysis of GNRHR2 expression in Raw 264.7.)

product-image-AAA24226_WB3.jpg WB (Western Blot) (GNRHR2 monoclonal antibody. Western Blot analysis of GNRHR2 expression in Raw 264.7.)

WB (Western Blot)

(GNRHR2 monoclonal antibody. Western Blot analysis of GNRHR2 expression in HepG2.)

product-image-AAA24226_WB2.jpg WB (Western Blot) (GNRHR2 monoclonal antibody. Western Blot analysis of GNRHR2 expression in HepG2.)

WB (Western Blot)

(Western Blot detection against Immunogen (32.27kD).)

product-image-AAA24226_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (32.27kD).)
Related Product Information for anti-GNRHR2 antibody
Putative receptor for gonadotropin releasing hormone II (GnRH II) which is most probably non-functional.
Product Categories/Family for anti-GNRHR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
frizzled-2
NCBI Official Synonym Full Names
frizzled class receptor 2
NCBI Official Symbol
FZD2
NCBI Official Synonym Symbols
Fz2; fz-2; fzE2; hFz2; OMOD2
NCBI Protein Information
frizzled-2
UniProt Protein Name
Frizzled-2
UniProt Gene Name
FZD2
UniProt Synonym Gene Names
Fz-2; hFz2
UniProt Entry Name
FZD2_HUMAN

Similar Products

Product Notes

The GNRHR2 fzd2 (Catalog #AAA24226) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GNRHR2 (Putative Gonadotropin-releasing Hormone II Receptor, GnRH II Receptor, GnRH-II-R, Type II GnRH Receptor) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GNRHR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNRHR2 fzd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNRHR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.