Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

IHC (Immunohistchemistry)
>
<
IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat testis using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

Rabbit anti-Human GST3/GSTP1 Monoclonal Antibody | anti-GSTP1 antibody

GST3/GSTP1 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
GST3/GSTP1; Monoclonal Antibody; GST3/GSTP1 Rabbit mAb; PI; DFN7; GST3; GSTP; FAEES3; HEL-S-22; anti-GSTP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
LRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVN
Applicable Applications for anti-GSTP1 antibody
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA)
Application Notes
WB: 1:500-1:1000
IHC-P: 1:500-1:2000
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 100-201 of human GST3/GSTP1 (P09211).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat testis using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Rat testis using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat liver using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat liver using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human placenta using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human placenta using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung adenocarcinoma using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human breast cancer using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human breast cancer using GST3/GSTP1 Rabbit mAb (AAA28477) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using GST3/GSTP1 Rabbit mAb (AAA28477) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot) (Western blot analysis of various lysates using GST3/GSTP1 Rabbit mAb (AAA28477) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)
Related Product Information for anti-GSTP1 antibody
Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and structural properties, the soluble GSTs are categorized into 4 main classes: alpha, mu, pi, and theta. This GST family member is a polymorphic gene encoding active, functionally different GSTP1 variant proteins that are thought to function in xenobiotic metabolism and play a role in susceptibility to cancer, and other diseases.
Product Categories/Family for anti-GSTP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 23kDa
Observed MW: 25kDa
UniProt Protein Name
Glutathione S-transferase P
UniProt Gene Name
GSTP1
UniProt Synonym Gene Names
FAEES3; GST3
UniProt Entry Name
GSTP1_HUMAN

Similar Products

GSTP1 ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

GSTP1 Antibody

Host: Rabbit
Reactivity: Pig, Human
Apps: Immunohistochemistry, Immunohistochemistry, Western Blot

GSTP1 Antibody

Host: Mouse
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, Immunocytochemistry, Flow Cytometry, Functional Assay

GSTP1 Antibody

Host: Rabbit
Reactivity: Human
Apps: Western Blot, Immunohistochemistry, ELISA

GST3 Antibody

Host: Rabbit
Reactivity: Human, Mouse
Apps: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry

TLR7 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TLR-7 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TLR7 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TLR4 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TLR9 Recombinant Protein

Host: E.coli
Reactivity: Homo sapiens (Human)
Apps: SDS-Page, Western Blot

TLR4 ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

TLR4 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TLR1 ELISA Kit

Host: n/a
Reactivity: Mouse
Apps: n/a

TLR4 ELISA Kit

Host: n/a
Reactivity: Rat
Apps: n/a

TLR-9 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TLR5 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

STLR4 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TLR2 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

TLR6 ELISA Kit

Host: n/a
Reactivity: Human
Apps: n/a

Product Notes

The GSTP1 gstp1 (Catalog #AAA28477) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GST3/GSTP1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GST3/GSTP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), ELISA (EIA). WB: 1:500-1:1000 IHC-P: 1:500-1:2000 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the GSTP1 gstp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LRCKYISLIY TNYEAGKDDY VKALPGQLKP FETLLSQNQG GKTFIVGDQI SFADYNLLDL LLIHEVLAPG CLDAFPLLSA YVGRLSARPK LKAFLASPEY VN. It is sometimes possible for the material contained within the vial of "GST3/GSTP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

aaabiotech.com © 2012-2025

All rights reserved.

Contact us by

Tel: +1 (619) 604-9440 | Fax: +1 (619) 604-9440
[email protected]

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.