Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24078_APP7.jpg Application Data (Detection limit for recombinant GST tagged HADHSC is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human HADHSC Monoclonal Antibody | anti-HADH antibody

HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-Co

Average rating 0.0
No ratings yet
Gene Names
HADH; HAD; HCDH; HHF4; HADH1; SCHAD; HADHSC; MSCHAD
Reactivity
Human
Applications
ELISA, Western Blot, Immunoprecipitation, Immunohistochemistry, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
HADHSC, Antibody; HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-Co; Anti -HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-Co; anti-HADH antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B5
Specificity
Recognizes human HADHSC.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
GKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Applicable Applications for anti-HADH antibody
ELISA, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry), IF (Immunofluorescence)
Application Notes
Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry.
Dilution: Immunofluorescence: 10ug/ml
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa205-314 from human HADHSC (NP_005318) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged HADHSC is ~0.03ng/ml as a capture antibody.)

product-image-AAA24078_APP7.jpg Application Data (Detection limit for recombinant GST tagged HADHSC is ~0.03ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of HADH transfected lysate using anti-HADH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HADH rabbit polyclonal antibody.)

product-image-AAA24078_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation of HADH transfected lysate using anti-HADH monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with HADH rabbit polyclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to HADHSC on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA24078_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to HADHSC on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to HADHSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

product-image-AAA24078_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to HADHSC on formalin-fixed paraffin-embedded human colon. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of HADH expression in transfected 293T cell line by HADHSC monoclonal antibody.Lane 1: HADH transfected lysate (34.3kD).Lane 2: Non-transfected lysate.)

product-image-AAA24078_WB3.jpg WB (Western Blot) (Western Blot analysis of HADH expression in transfected 293T cell line by HADHSC monoclonal antibody.Lane 1: HADH transfected lysate (34.3kD).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(HADHSC monoclonal antibody Western Blot analysis of HADHSC expression in HepG2.)

product-image-AAA24078_WB2.jpg WB (Western Blot) (HADHSC monoclonal antibody Western Blot analysis of HADHSC expression in HepG2.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.84kD).)

product-image-AAA24078_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37.84kD).)
Related Product Information for anti-HADH antibody
HADH, which belongs to the family of oxidoreductases, is important for converting certain fats to energy. This protein is an enzyme that catalyzes the chemical reaction. ((S)-3-hydroxyacyl-CoA + NAD+ <=>3-oxoacyl-CoA + NADH + H+) It is also involved in a process called fatty acid oxidation, in which several enzymes work in a step-wise fashion to break down (metabolize) fats and convert them to energy.
Product Categories/Family for anti-HADH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,294 Da
NCBI Official Full Name
hydroxyacyl-coenzyme A dehydrogenase, mitochondrial isoform 2
NCBI Official Synonym Full Names
hydroxyacyl-CoA dehydrogenase
NCBI Official Symbol
HADH
NCBI Official Synonym Symbols
HAD; HCDH; HHF4; HADH1; SCHAD; HADHSC; MSCHAD
NCBI Protein Information
hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; short-chain 3-hydroxyacyl-CoA dehydrogenase; L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain; medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase
UniProt Protein Name
Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
UniProt Gene Name
HADH
UniProt Synonym Gene Names
HAD; HADHSC; SCHAD; HCDH
UniProt Entry Name
HCDH_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HADH hadh (Catalog #AAA24078) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HADHSC (L-3-Hydroxyacyl Coenzyme A Dehydrogenase Short Chain, Hydroxyacyl-coenzyme A Dehydrogenase Mitochondrial, HAD, HADH, HADH1, HCDH, HHF4, Medium and Short Chain L-3-Hydroxyacyl-coenzyme A Dehydrogenase, M/SCHAD, MGC8392, Short Chain 3-Hydroxyacyl-Co reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HADHSC can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry), IF (Immunofluorescence). Suitable for use in Immunofluorescence, ELISA, Western Blot, Immunoprecipitation and Immunohistochemistry. Dilution: Immunofluorescence: 10ug/ml Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the HADH hadh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GKHPVSCKDT PGFIVNRLLV PYLMEAIRLY ERGDASKEDI DTAMKLGAGY PMGPFELLDY VGLDTTKFIV DGWHEMDAEN PLHQPSPSLN KLVAENKFGK KTGEGFYKYK. It is sometimes possible for the material contained within the vial of "HADHSC, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.