Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282730_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation of HDAC3 from 300 ug extracts of HeLa cells was performed using 3 ug of HDAC3 Rabbit mAb (AAA282730). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using HDAC3 Rabbit mAb (AAA282730) at a dilution of 1:1000.)

Rabbit anti-Human HDAC3 Monoclonal Antibody | anti-HDAC3 antibody

HDAC3 Rabbit mAb

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Affinity purification
Synonyms
HDAC3, Antibody; HDAC3 Rabbit mAb; HD3; RPD3; KDAC3; RPD3-2; HDAC3; anti-HDAC3 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
FEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Applicable Applications for anti-HDAC3 antibody
ELISA, IP (Immunoprecipitation), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 329-428 of human HDAC3 (NP_003874.2).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation of HDAC3 from 300 ug extracts of HeLa cells was performed using 3 ug of HDAC3 Rabbit mAb (AAA282730). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using HDAC3 Rabbit mAb (AAA282730) at a dilution of 1:1000.)

product-image-AAA282730_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation of HDAC3 from 300 ug extracts of HeLa cells was performed using 3 ug of HDAC3 Rabbit mAb (AAA282730). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using HDAC3 Rabbit mAb (AAA282730) at a dilution of 1:1000.)

WB (Western Blot)

(Western blot analysis of various lysates using HDAC3 Rabbit mAb (AAA282730) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)

product-image-AAA282730_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using HDAC3 Rabbit mAb (AAA282730) at 1:1000 dilution incubated overnight at 4?.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)
Related Product Information for anti-HDAC3 antibody
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 49kDa
Observed MW: 49kDa
UniProt Protein Name
Histone deacetylase 3
UniProt Gene Name
HDAC3
UniProt Synonym Gene Names
HD3
UniProt Entry Name
HDAC3_HUMAN

Similar Products

Product Notes

The HDAC3 hdac3 (Catalog #AAA282730) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HDAC3 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HDAC3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the HDAC3 hdac3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FEYFAPDFTL HPDVSTRIEN QNSRQYLDQI RQTIFENLKM LNHAPSVQIH DVPADLLTYD RTDEADAEER GPEENYSRPE APNEFYDGDH DNDKESDVEI. It is sometimes possible for the material contained within the vial of "HDAC3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.