Loading...

Skip to main content
WB (Western Blot) (HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.)

Mouse anti-Human HHIP Monoclonal Antibody | anti-HHIP antibody

HHIP (Hedgehog-interacting Protein, HHIP, HIP, UNQ5825/PRO19644, FLJ20992, FLJ90230) (HRP)

Gene Names
HHIP; HIP
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HHIP, Antibody; HHIP (Hedgehog-interacting Protein, HHIP, HIP, UNQ5825/PRO19644, FLJ20992, FLJ90230) (HRP); HHIP; anti-HHIP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5D11
Specificity
Recognizes human HHIP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HHIP antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-121 from human HHIP (NP_071920) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.)

WB (Western Blot) (HHIP monoclonal antibody. Western Blot analysis of HHIP expression in MCF-7.)

WB (Western Blot)

(HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.)

WB (Western Blot) (HHIP monoclonal antibody, Western Blot analysis of HHIP expression in Hela NE.)

Application Data

(Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged HHIP is ~1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of HHIP transfected lysate using HHIP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with HHIP rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to HHIP on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of HHIP expression in transfected 293T cell line by HHIP monoclonal antibody. Lane 1: HHIP transfected lysate (78.9kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.11kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-HHIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,373 Da
NCBI Official Full Name
hedgehog-interacting protein
NCBI Official Synonym Full Names
hedgehog interacting protein
NCBI Official Symbol
HHIP
NCBI Official Synonym Symbols
HIP
NCBI Protein Information
hedgehog-interacting protein
UniProt Protein Name
Hedgehog-interacting protein
UniProt Gene Name
HHIP
UniProt Synonym Gene Names
HIP; HHIP; HIP
UniProt Entry Name
HHIP_HUMAN

Similar Products

Product Notes

The HHIP hhip (Catalog #AAA25418) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HHIP (Hedgehog-interacting Protein, HHIP, HIP, UNQ5825/PRO19644, FLJ20992, FLJ90230) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HHIP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HHIP hhip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HHIP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.