Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126897_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of CACO-2 cells using anti-Hsp90 beta/HSP90AB1 antibody (AAA126897).Overlay histogram showing CACO-2 cells stained with AAA126897 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Hsp90 beta/HSP90AB1 Antibody (AAA126897, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse Hsp90 beta/HSP90AB1 Monoclonal Antibody | anti-HSP90AB1 antibody

Anti-Hsp90 beta/HSP90AB1 Antibody Picoband (monoclonal, 7B7F5)

Average rating 0.0
No ratings yet
Gene Names
HSP90AB1; HSP84; HSPC2; HSPCB; D6S182; HSP90B
Reactivity
Human, Mouse, Rat
Applications
Flow Cytometry, Functional Assay, Immunofluorescence, Immunocytochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Hsp90 beta/HSP90AB1, Antibody; Anti-Hsp90 beta/HSP90AB1 Antibody Picoband (monoclonal, 7B7F5); anti-HSP90AB1 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2b
Clone Number
7B7F5
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-HSP90AB1 antibody
FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), WB (Western Blot)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months.Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of CACO-2 cells using anti-Hsp90 beta/HSP90AB1 antibody (AAA126897).Overlay histogram showing CACO-2 cells stained with AAA126897 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Hsp90 beta/HSP90AB1 Antibody (AAA126897, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126897_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of CACO-2 cells using anti-Hsp90 beta/HSP90AB1 antibody (AAA126897).Overlay histogram showing CACO-2 cells stained with AAA126897 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Hsp90 beta/HSP90AB1 Antibody (AAA126897, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 2. IF analysis of Hsp90 beta/HSP90AB1 using anti-Hsp90 beta/HSP90AB1 antibody (AAA126897).Hsp90 beta/HSP90AB1 was detected in an immunocytochemical section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-Hsp90 beta/HSP90AB1 Antibody (AAA126897) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA126897_IF13.jpg IF (Immunofluorescence) (Figure 2. IF analysis of Hsp90 beta/HSP90AB1 using anti-Hsp90 beta/HSP90AB1 antibody (AAA126897).Hsp90 beta/HSP90AB1 was detected in an immunocytochemical section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 5 ug/mL mouse anti-Hsp90 beta/HSP90AB1 Antibody (AAA126897) overnight at 4 degree C. DyLight488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37 degree C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

WB (Western Blot)

(Figure 1. Western blot analysis of Hsp90 beta/HSP90AB1 using anti-Hsp90 beta/HSP90AB1 antibody (AAA126897).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human Jurkat whole cell lysates,Lane 3: human Raji whole cell lysates,Lane 4: human A431 whole cell lysates,Lane 5: rat brain tissue lysates,Lane 6: rat heart tissue lysates,Lane 7: mouse brain tissue lysates,Lane 8: mouse heart tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Hsp90 beta/HSP90AB1 antigen affinity purified monoclonal antibody (#AAA126897) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Hsp90 beta/HSP90AB1 at approximately 90 kDa. The expected band size for Hsp90 beta/HSP90AB1 is at 84 kDa.)

product-image-AAA126897_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of Hsp90 beta/HSP90AB1 using anti-Hsp90 beta/HSP90AB1 antibody (AAA126897).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Hela whole cell lysates,Lane 2: human Jurkat whole cell lysates,Lane 3: human Raji whole cell lysates,Lane 4: human A431 whole cell lysates,Lane 5: rat brain tissue lysates,Lane 6: rat heart tissue lysates,Lane 7: mouse brain tissue lysates,Lane 8: mouse heart tissue lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Hsp90 beta/HSP90AB1 antigen affinity purified monoclonal antibody (#AAA126897) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Hsp90 beta/HSP90AB1 at approximately 90 kDa. The expected band size for Hsp90 beta/HSP90AB1 is at 84 kDa.)
Related Product Information for anti-HSP90AB1 antibody
Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.
Product Categories/Family for anti-HSP90AB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,264 Da
NCBI Official Full Name
heat shock protein HSP 90-beta isoform a
NCBI Official Synonym Full Names
heat shock protein 90kDa alpha (cytosolic), class B member 1
NCBI Official Symbol
HSP90AB1
NCBI Official Synonym Symbols
HSP84; HSPC2; HSPCB; D6S182; HSP90B
NCBI Protein Information
heat shock protein HSP 90-beta; HSP90-beta; heat shock 84 kDa; heat shock 90kD protein 1, beta
UniProt Protein Name
Heat shock protein HSP 90-beta
UniProt Gene Name
HSP90AB1
UniProt Synonym Gene Names
HSP90B; HSPC2; HSPCB; HSP 90; HSP 84; HSP84
UniProt Entry Name
HS90B_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HSP90AB1 hsp90ab1 (Catalog #AAA126897) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Hsp90 beta/HSP90AB1 Antibody Picoband (monoclonal, 7B7F5) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hsp90 beta/HSP90AB1 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IF (Immunofluorescence), ICC (Immunocytochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the HSP90AB1 hsp90ab1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hsp90 beta/HSP90AB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.