Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25424_WB6.jpg WB (Western Blot) (HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in PC-12.)

Mouse anti-Human, Rat HSPA1L Monoclonal Antibody | anti-HSPA1L antibody

HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-Hom, Heat shock 70kD protein 1L, Heat Shock 70kD Protein 1-Hom) (HRP)

Average rating 0.0
No ratings yet
Gene Names
HSPA1L; HSP70T; hum70t; HSP70-1L; HSP70-HOM
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HSPA1L, Antibody; HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-Hom, Heat shock 70kD protein 1L, Heat Shock 70kD Protein 1-Hom) (HRP); anti-HSPA1L antibody
Ordering
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7H6
Specificity
Recognizes human HSPA1L. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HSPA1L antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa561-641 from human HSPA1L (NP_005518) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in PC-12.)

product-image-AAA25424_WB6.jpg WB (Western Blot) (HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in PC-12.)

Application Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP3K7 and HSPA1L HeLa cells were stained with MAP3K7 rabbit purified polyclonal 1:1200 and HSPA1L mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

product-image-AAA25424_APP5.jpg Application Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAP3K7 and HSPA1L HeLa cells were stained with MAP3K7 rabbit purified polyclonal 1:1200 and HSPA1L mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Application Data

(Detection limit for recombinant GST tagged HSPA1L is ~0.1ng/ml as a capture antibody.)

product-image-AAA25424_APP4.jpg Application Data (Detection limit for recombinant GST tagged HSPA1L is ~0.1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to HSPA1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

product-image-AAA25424_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to HSPA1L on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

WB (Western Blot)

(HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in HeLa.)

product-image-AAA25424_WB2.jpg WB (Western Blot) (HSPA1L monoclonal antibody Western Blot analysis of HSPA1L expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (34.65kD).)

product-image-AAA25424_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (34.65kD).)
Product Categories/Family for anti-HSPA1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,375 Da
NCBI Official Full Name
heat shock 70 kDa protein 1-like
NCBI Official Synonym Full Names
heat shock 70kDa protein 1-like
NCBI Official Symbol
HSPA1L
NCBI Official Synonym Symbols
HSP70T; hum70t; HSP70-1L; HSP70-HOM
NCBI Protein Information
heat shock 70 kDa protein 1-like; heat shock 70 kDa protein 1L; heat shock 70kD protein-like 1; heat shock 10kDa protein 1-like; heat shock 70 kDa protein 1-Hom
UniProt Protein Name
Heat shock 70 kDa protein 1-like
UniProt Gene Name
HSPA1L
UniProt Synonym Gene Names
Heat shock 70 kDa protein 1L; HSP70-Hom
UniProt Entry Name
HS71L_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The HSPA1L hspa1l (Catalog #AAA25424) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HSPA1L (Heat Shock 70kD Protein 1-like, HSP70-Hom, Heat shock 70kD protein 1L, Heat Shock 70kD Protein 1-Hom) (HRP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA1L can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HSPA1L hspa1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HSPA1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.