Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25722_APP6.jpg Application Data (Detection limit for recombinant GST tagged IFI16 is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human IFI16 Monoclonal Antibody | anti-IFI16 antibody

IFI16 (Interferon gamma-inducible Protein 16, Gamma-interferon-inducible Protein 16, Ifi-16, IFNGIP1, Interferon-inducible Myeloid Differentiation Transcriptional Activator, MGC9466, PYHIN2) (PE)

Average rating 0.0
No ratings yet
Gene Names
IFI16; PYHIN2; IFNGIP1
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IFI16, Antibody; IFI16 (Interferon gamma-inducible Protein 16, Gamma-interferon-inducible Protein 16, Ifi-16, IFNGIP1, Interferon-inducible Myeloid Differentiation Transcriptional Activator, MGC9466, PYHIN2) (PE); anti-IFI16 antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E3
Specificity
Recognizes human IFI16.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-IFI16 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa630-729 from human IFI16 (AAH17059) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged IFI16 is ~0.3ng/ml as a capture antibody.)

product-image-AAA25722_APP6.jpg Application Data (Detection limit for recombinant GST tagged IFI16 is ~0.3ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to IFI16 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA25722_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to IFI16 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

product-image-AAA25722_IHC4.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of IFI16 expression in transfected 293T cell line by IFI16 monoclonal antibody. Lane 1: IFI16 transfected lysate (82kD). Lane 2: Non-transfected lysate.)

product-image-AAA25722_WB3.jpg WB (Western Blot) (Western Blot analysis of IFI16 expression in transfected 293T cell line by IFI16 monoclonal antibody. Lane 1: IFI16 transfected lysate (82kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(IFI16 monoclonal antibody Western Blot analysis of IFI16 expression in Hela NE.)

product-image-AAA25722_WB2.jpg WB (Western Blot) (IFI16 monoclonal antibody Western Blot analysis of IFI16 expression in Hela NE.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

product-image-AAA25722_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (36.74kD).)
Product Categories/Family for anti-IFI16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
82,588 Da
NCBI Official Full Name
Homo sapiens interferon, gamma-inducible protein 16, mRNA
NCBI Official Synonym Full Names
interferon gamma inducible protein 16
NCBI Official Symbol
IFI16
NCBI Official Synonym Symbols
PYHIN2; IFNGIP1
NCBI Protein Information
gamma-interferon-inducible protein 16

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The IFI16 (Catalog #AAA25722) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IFI16 (Interferon gamma-inducible Protein 16, Gamma-interferon-inducible Protein 16, Ifi-16, IFNGIP1, Interferon-inducible Myeloid Differentiation Transcriptional Activator, MGC9466, PYHIN2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IFI16 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IFI16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IFI16, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.