WB (Western Blot)
(Western blot analysis of Recombinant Mouse IFN-gamma Protein (RP01070), using IFN gamma Rabbit mAb (AAA283001) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 1ng/0.5ng per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
Rabbit anti-Rat IFN gamma Monoclonal Antibody | anti-Ifng antibody
IFN gamma Rabbit mAb
Reactivity
Rat
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
IFN gamma, Antibody; IFN gamma Rabbit mAb; If2f; IFNG2; IFN gamma; anti-Ifng antibody
Host
Rabbit
Reactivity
Rat
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
CYCQGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKR
Applicable Applications for anti-Ifng antibody
ELISA, WB (Western Blot)
Cross Reactivity
Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 20-153 of rat IFN gamma (NP_620235.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of Recombinant Mouse IFN-gamma Protein (RP01070), using IFN gamma Rabbit mAb (AAA283001) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 1ng/0.5ng per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
WB (Western Blot)
(Western blot analysis of Recombinant Mouse IFN-gamma Protein (RP01070), using IFN gamma Rabbit mAb (AAA283001) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 1ng/0.5ng per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
WB (Western Blot)
(Western blot analysis of Recombinant Rat IFN-gamma Protein (RP01075), using IFN gamma Rabbit mAb (AAA283001) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 1ng/0.5ng per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
WB (Western Blot)
(Western blot analysis of Recombinant Rat IFN-gamma Protein (RP01075), using IFN gamma Rabbit mAb (AAA283001) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 1ng/0.5ng per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.)
Related Product Information for anti-Ifng antibody
Predicted to enable cytokine activity. Involved in several processes, including negative regulation of cell population proliferation; positive regulation of NMDA glutamate receptor activity; and positive regulation of macromolecule metabolic process. Located in several cellular components, including extracellular space; neuron projection; and perikaryon. Used to study several diseases, including Chagas disease; allergic conjunctivitis; allergic rhinitis; renal fibrosis; and ureteral obstruction. Biomarker of several diseases, including abdominal aortic aneurysm; autoimmune thyroiditis; pulpitis; tongue squamous cell carcinoma; and visual epilepsy. Human ortholog(s) of this gene implicated in several diseases, including ataxia telangiectasia; autoimmune disease (multiple); eczema herpeticum; factor VIII deficiency; and leukemia (multiple). Orthologous to human IFNG (interferon gamma).
Product Categories/Family for anti-Ifng antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 18kDa
Observed MW: 50-55kDa
Observed MW: 50-55kDa
UniProt Protein Name
Interferon gamma
UniProt Gene Name
Ifng
UniProt Synonym Gene Names
IFN-gamma
UniProt Entry Name
IFNG_RAT
Similar Products
Product Notes
The Ifng ifng (Catalog #AAA283001) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IFN gamma Rabbit mAb reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IFN gamma can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the Ifng ifng for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CYCQGTLIES LESLKNYFNS SSMDAMEGKS LLLDIWRNWQ KDGNTKILES QIISFYLRLF EVLKDNQAIS NNISVIESHL ITNFFSNSKA KKDAFMSIAK FEVNNPQIQH KAVNELIRVI HQLSPESSLR KRKR. It is sometimes possible for the material contained within the vial of "IFN gamma, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.