Loading...

Skip to main content
WB (Western Blot) (Western blot analysis of SP110 over-expressed 293 cell line, cotransfected with SP110 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SP110 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human IPR1 Monoclonal Antibody | anti-IPR1 antibody

IPR1 (SP110, Sp110 Nuclear Body Protein, Interferon-induced Protein 41/75, Speckled 110kD, Transcriptional Coactivator Sp110) (FITC)

Gene Names
SP110; IPR1; VODI; IFI41; IFI75
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
IPR1, Antibody; IPR1 (SP110, Sp110 Nuclear Body Protein, Interferon-induced Protein 41/75, Speckled 110kD, Transcriptional Coactivator Sp110) (FITC); anti-IPR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8C8
Specificity
Recognizes human SP110.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-IPR1 antibody
ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa271-380 from human SP110 (NP_004501) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of SP110 over-expressed 293 cell line, cotransfected with SP110 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SP110 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of SP110 over-expressed 293 cell line, cotransfected with SP110 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SP110 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged SP110 is ~0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged SP110 is ~0.1ng/ml as a capture antibody.)

IP (Immunoprecipitation)

(Immunoprecipitation of SP110 transfected lysate using SP110 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SP110 rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of SP110 transfected lysate using SP110 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SP110 rabbit polyclonal antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to SP110 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to SP110 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of SP110 expression in transfected 293T cell line by SP110 monoclonal antibody. Lane 1: SP110 transfected lysate (61.8kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of SP110 expression in transfected 293T cell line by SP110 monoclonal antibody. Lane 1: SP110 transfected lysate (61.8kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(SP110 monoclonal antibody. Western Blot analysis of SP110 expression in Jurkat.)

WB (Western Blot) (SP110 monoclonal antibody. Western Blot analysis of SP110 expression in Jurkat.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.84kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.84kD).)
Product Categories/Family for anti-IPR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,603 Da
NCBI Official Full Name
sp110 nuclear body protein isoform b
NCBI Official Synonym Full Names
SP110 nuclear body protein
NCBI Official Symbol
SP110
NCBI Official Synonym Symbols
IPR1; VODI; IFI41; IFI75
NCBI Protein Information
sp110 nuclear body protein; speckled 110 kDa; phosphoprotein 41; phosphoprotein 75; interferon-induced protein 41/75; transcriptional coactivator Sp110; interferon-induced protein 41, 30kD; interferon-induced protein 75, 52kD
UniProt Protein Name
Sp110 nuclear body protein
UniProt Gene Name
SP110
UniProt Entry Name
SP110_HUMAN

Similar Products

Product Notes

The IPR1 sp110 (Catalog #AAA25135) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IPR1 (SP110, Sp110 Nuclear Body Protein, Interferon-induced Protein 41/75, Speckled 110kD, Transcriptional Coactivator Sp110) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IPR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IPR1 sp110 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IPR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.