Mouse anti-Human IRF2 Monoclonal Antibody | anti-IRF2 antibody

IRF2 (IRF-2, Interferon Regulatory Factor 2) (Biotin)

Cat. Num. AAA24840

• Gene Names: IRF2; IRF-2
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IRF2, Antibody; IRF2 (IRF-2, Interferon Regulatory Factor 2) (Biotin); anti-IRF2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3B5
• Specificity: Recognizes human IRF2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.4. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-IRF2 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa216-315 from human IRF2 (NM_002199; NP_002190) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of IRF2 expression in transfected 293T cell line by IRF2 monoclonal antibody. Lane 1: IRF2 transfected lysate (39.4kD). Lane 2: Non-transfected lysate.)

Application Data

(Detection limit for 128582 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence in HeLa cells using 128582 (10ug/ml).)

IHC (Immunohistochemistry)

(Immunoperoxidase in formalin-fixed paraffin-embedded human leiomyosarcoma usign 128582 (3ug/ml).)

WB (Western Blot)

(Western Blot analysis of IRF2 expression in Hela NE using 128582.)

WB (Western Blot)

(Western Blot detection against Immunogen (36.74kD).)

Related Product Information for anti-IRF2 antibody

IRF2BP2 encodes an interferon regulatory factor-2 (IRF2) binding protein that interacts with the C-terminal transcriptional repression domain of IRF2. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq].

Product Categories/Family for anti-IRF2 antibody

Antibodies; Interferon

NCBI and Uniprot Product Information

• NCBI GI #: 153082752
• NCBI GeneID: 3660
• NCBI Accession #: NP_002190
• NCBI GenBank Nucleotide #: NM_002199
• UniProt Accession #: P14316; Q6IAS7; Q96B99; D6RCK5; H0Y8S3
• Molecular Weight: 15 kDa (133 aa), confirmed by MALDI-TOF.
• NCBI Official Full Name: interferon regulatory factor 2
• NCBI Official Synonym Full Names: interferon regulatory factor 2
• NCBI Official Symbol: IRF2
• NCBI Official Synonym Symbols: IRF-2
• NCBI Protein Information: interferon regulatory factor 2
• UniProt Protein Name: Interferon regulatory factor 2
• UniProt Gene Name: IRF2
• UniProt Synonym Gene Names: IRF-2
• UniProt Entry Name: IRF2_HUMAN